Active Recombinant Human IL12B Protein

Cat.No. : IL12B-181I
Product Overview : Recombinant Human IL12B Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : Interleukin 12 (IL-12), also known as natural killer cell stimulatory factor (NKSF) or cytotoxic lymphocyte maturation factor (CLMF), is a pleiotropic cytokine originally identified in the medium of activated human B lymphoblastoid cell lines. The p40 subunit of IL-12 has been shown to have extensive amino acid sequence homology to the extracellular domain of the human IL-6 receptor while the p35 subunit shows distant but significant sequence similarity to IL-6, G-CSF, and chicken MGF. These observations have led to the suggestion that IL-12 might have evolved from a cytokine/soluble receptor complex. Human and mouse IL-12 share 70% and 60% amino acid sequence homology in their p40 and p35 subunits, respectively. IL-12 apparently shows species specificity with human IL-12 reportedly showing minimal activity in the mouse system.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : EC50 < 2 ng/mL, measured by the induction of IFN-γ from NK cells co-stimulated with IL-18, corresponding to a specific activity of > 1 × 10^6 units/mg.
Molecular Mass : Approximately 75 kDa, consisting of a 306 amino acid residue p40 subunit and a 197 amino acid residue p35 subunit.
AA Sequence : p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
p40:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human Interleukin 12(IL-12) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rh-IL12 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens ]
Official Symbol IL12B
Synonyms IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B;
Gene ID 3593
mRNA Refseq NM_002187
Protein Refseq NP_002178
MIM 161561
UniProt ID P29460

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12B Products

Required fields are marked with *

My Review for All IL12B Products

Required fields are marked with *

0
cart-icon
0
compare icon