| Species : |
Human |
| Source : |
CHO |
| Description : |
Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and mouse IL-13 is cross-species reactive. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 15 ng/mL, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 6.7 × 10^5 units/mg. |
| Molecular Mass : |
25-45 kDa, observed by non-reducing SDS-PAGE. |
| AA Sequence : |
SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE. |
| Storage : |
Lyophilized recombinant human Interleukin 13 (IL-13) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-13 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |