Active Recombinant Human IL18BP Protein

Cat.No. : IL18BP-75H
Product Overview : Recombinant Human IL18BP Protein without tag wass expressed in CHO.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Bio-activity : ED50 < 30 ng/mL, measured in a bioassay using KG-1 cells in the presence of 50 ng/mL Human IL-18.
Molecular Mass : 42-44 kDa, observed by reducing SDS-PAGE.
AA Sequence : TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Endotoxin : < 0.2 EU/μg determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human IL-18BP remains stable up to 6 months at lower than -70 centigrade from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL18BP interleukin 18 binding protein [ Homo sapiens (human) ]
Official Symbol IL18BP
Synonyms IL18BP; interleukin 18 binding protein; FVH; IL18BPa; interleukin-18-binding protein; MC51L-53L-54L homolog gene product; tadekinig-alfa
Gene ID 10068
mRNA Refseq NM_173044
Protein Refseq NP_766632
MIM 604113
UniProt ID O95998

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL18BP Products

Required fields are marked with *

My Review for All IL18BP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon