Active Recombinant Human IL1RL1, His-tagged, Biotinylated

Cat.No. : IL1RL1-629H
Product Overview : The recombinant human IL1RL1 ECD is expressed as a 320 amino acid protein consisting of Lys19 - Ser328 region of IL1RL1/ST2 (UniProt accession #Q01638) and a C-terminal His-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 19-328 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized IL1RL1 binds human IL33 in a functional ELISA. Blocks IL33-dependent signaling activity in helper T cells.
Molecular Mass : Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 (probably due to glycosylation).
AA Sequence : KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSP TFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFL VIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRR HTVRLSRKNPIDHHSTGHHHHHHHH
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ]
Official Symbol IL1RL1
Synonyms IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623;
Gene ID 9173
mRNA Refseq NM_003856
Protein Refseq NP_003847
MIM 601203
UniProt ID Q01638
Chromosome Location 2q12
Function cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1RL1 Products

Required fields are marked with *

My Review for All IL1RL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon