Active Recombinant Human IL1RL1, His-tagged, Biotinylated
| Cat.No. : | IL1RL1-629H |
| Product Overview : | The recombinant human IL1RL1 ECD is expressed as a 320 amino acid protein consisting of Lys19 - Ser328 region of IL1RL1/ST2 (UniProt accession #Q01638) and a C-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | 19-328 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Immobilized IL1RL1 binds human IL33 in a functional ELISA. Blocks IL33-dependent signaling activity in helper T cells. |
| Molecular Mass : | Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 (probably due to glycosylation). |
| AA Sequence : | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSP TFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFL VIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRR HTVRLSRKNPIDHHSTGHHHHHHHH |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ] |
| Official Symbol | IL1RL1 |
| Synonyms | IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623; |
| Gene ID | 9173 |
| mRNA Refseq | NM_003856 |
| Protein Refseq | NP_003847 |
| MIM | 601203 |
| UniProt ID | Q01638 |
| Chromosome Location | 2q12 |
| Function | cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity; |
| ◆ Recombinant Proteins | ||
| IL1RL1-774H | Active Recombinant Human IL1RL1 protein(Met1-Phe328), hFc-tagged | +Inquiry |
| IL1RL1-2257H | Recombinant Human IL1RL1, His tagged | +Inquiry |
| IL1RL1-1637H | Recombinant Human Interleukin 1 Receptor-Like 1 | +Inquiry |
| Il1rl1-1752M | Recombinant Mouse Interleukin 1 Receptor-like 1, Fc-tagged | +Inquiry |
| IL1RL1-2191C | Recombinant Chicken IL1RL1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
| IL1RL1-1883HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
| IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RL1 Products
Required fields are marked with *
My Review for All IL1RL1 Products
Required fields are marked with *



