Active Recombinant Human IL1RL1, His-tagged, Biotinylated
Cat.No. : | IL1RL1-629H |
Product Overview : | The recombinant human IL1RL1 ECD is expressed as a 320 amino acid protein consisting of Lys19 - Ser328 region of IL1RL1/ST2 (UniProt accession #Q01638) and a C-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 19-328 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized IL1RL1 binds human IL33 in a functional ELISA. Blocks IL33-dependent signaling activity in helper T cells. |
Molecular Mass : | Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 (probably due to glycosylation). |
AA Sequence : | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSP TFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFL VIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRR HTVRLSRKNPIDHHSTGHHHHHHHH |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >90% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ] |
Official Symbol | IL1RL1 |
Synonyms | IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623; |
Gene ID | 9173 |
mRNA Refseq | NM_003856 |
Protein Refseq | NP_003847 |
MIM | 601203 |
UniProt ID | Q01638 |
Chromosome Location | 2q12 |
Function | cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity; |
◆ Recombinant Proteins | ||
IL1RL1-3991H | Active Recombinant Human IL1RL1 protein, His-tagged | +Inquiry |
Il1rl1-1752M | Recombinant Mouse Interleukin 1 Receptor-like 1, Fc-tagged | +Inquiry |
Il1rl1-5714M | Recombinant Mouse Il1rl1 Protein (Ser27-Ala337), C-Fc tagged | +Inquiry |
IL1RL1-317H | Recombinant Human IL1RL1 Protein, His-tagged | +Inquiry |
IL1RL1-5287H | Recombinant Human IL1RL1 Protein (Lys19-Phe328), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RL1-1883HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RL1 Products
Required fields are marked with *
My Review for All IL1RL1 Products
Required fields are marked with *