Active Recombinant Human IL6R Protein
Cat.No. : | IL6R-235I |
Product Overview : | Recombinant Human IL6R Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.2 μg/mL, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/mL human IL-6. |
Molecular Mass : | 54-56 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL6R interleukin 6 receptor [ Homo sapiens (human) ] |
Official Symbol | IL6R |
Synonyms | IL6R; interleukin 6 receptor; IL6Q; gp80; CD126; HIES5; IL-6R; IL6RA; IL6RQ; IL-1Ra; IL-6RA; IL6QTL; IL-6R-1; interleukin-6 receptor subunit alphaCD126 antigenIL-6 receptor subunit alphamembrane glycoprotein 80 |
Gene ID | 3570 |
mRNA Refseq | NM_000565 |
Protein Refseq | NP_000556 |
MIM | 147880 |
UniProt ID | P08887 |
◆ Recombinant Proteins | ||
IL6R-5175H | Recombinant Human IL6R Protein | +Inquiry |
IL6R-1064C | Active Recombinant Canine IL6R protein, His-tagged | +Inquiry |
IL6R-0186M | Active Recombinant Mouse IL6R protein, His-Avi-tagged, Biotinylated | +Inquiry |
RFL24812SF | Recombinant Full Length Pig Interleukin-6 Receptor Subunit Alpha(Il6R) Protein, His-Tagged | +Inquiry |
IL6R-1593H | Recombinant Human IL6R Protein (Met1-Pro365), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *
0
Inquiry Basket