Active Recombinant Human IL6R Protein

Cat.No. : IL6R-235I
Product Overview : Recombinant Human IL6R Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.2 μg/mL, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/mL human IL-6.
Molecular Mass : 54-56 kDa, observed by reducing SDS-PAGE.
AA Sequence : LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL6R interleukin 6 receptor [ Homo sapiens (human) ]
Official Symbol IL6R
Synonyms IL6R; interleukin 6 receptor; IL6Q; gp80; CD126; HIES5; IL-6R; IL6RA; IL6RQ; IL-1Ra; IL-6RA; IL6QTL; IL-6R-1; interleukin-6 receptor subunit alphaCD126 antigenIL-6 receptor subunit alphamembrane glycoprotein 80
Gene ID 3570
mRNA Refseq NM_000565
Protein Refseq NP_000556
MIM 147880
UniProt ID P08887

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6R Products

Required fields are marked with *

My Review for All IL6R Products

Required fields are marked with *

0
cart-icon
0
compare icon