Active Recombinant Human MICA Protein, His-tagged

Cat.No. : MICA-03H
Product Overview : Recombinant human MICA, fused to His-tag at C-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human NKG2D.
Molecular Mass : 32.7 kDa (283aa) confirmed by MALDI-TOF
AA Sequence : MEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% Glycerol
Gene Name MICA MHC class I polypeptide-related sequence A [ Homo sapiens (human) ]
Official Symbol MICA
Synonyms MICA; MHC class I polypeptide-related sequence A; MIC-A; PERB11.1; MHC class I polypeptide-related sequence A; HLA class I antigen; MHC class I chain-related protein A; MHC class I related chain A; MHC class I related sequence A; major histocompatibility complex class I chain-related protein A; stress inducible class I homolog
Gene ID 100507436
mRNA Refseq NM_000247
Protein Refseq NP_000238
MIM 600169
UniProt ID Q29983

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MICA Products

Required fields are marked with *

My Review for All MICA Products

Required fields are marked with *

0
cart-icon
0
compare icon