Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Description : |
This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. |
Form : |
Liquid |
Bio-activity : |
Measured by its binding ability in a functional ELISA with Human NKG2D. |
Molecular Mass : |
32.7 kDa (283aa) confirmed by MALDI-TOF |
AA Sequence : |
MEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS |
Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
Purity : |
> 90% by SDS-PAGE |
Applications : |
SDS-PAGE, Bioactivity |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : |
0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : |
20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% Glycerol |