Active Recombinant Human NOG Protein

• Cat.No.: NOG-001H
• Product Overview: Recombinant Human Noggin consisting of two 205 amino acid polypeptide chains without tag was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Bio-activity: Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 2.0-3.0 ng/ml of Noggin.
• Molecular Mass: 46 kDa
• AA Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
• Purity: ≥ 95% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: NOG noggin [ Homo sapiens (human) ]
• Official Symbol: NOG
• Synonyms: NOG; noggin; SYM1; SYNS1; SYNS1A
• Gene ID: 9241
• mRNA Refseq: NM_005450
• Protein Refseq: NP_005441
• MIM: 602991
• UniProt ID: Q13253