| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6. |
| Bio-activity : |
Determined by its ability to inhibit 5.0 ng/mL of BMP-4 induced alkaline phosphatase production by ATDC5 chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/mL of Noggin. |
| Molecular Mass : |
46.4 kDa |
| AA Sequence : |
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Endotoxin : |
< 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : |
> 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. |
| Storage Buffer : |
LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |