Active Recombinant Mouse Nog Protein
Cat.No. : | Nog-4452M |
Product Overview : | Purified recombinant protein of Mouse noggin (Nog) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6. |
Bio-activity : | Determined by its ability to inhibit 5.0 ng/mL of BMP-4 induced alkaline phosphatase production by ATDC5 chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/mL of Noggin. |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Nog noggin [ Mus musculus (house mouse) ] |
Official Symbol | Nog |
Synonyms | NOG; noggin |
Gene ID | 18121 |
mRNA Refseq | NM_008711 |
Protein Refseq | NP_032737 |
UniProt ID | P97466 |
◆ Recombinant Proteins | ||
NOG-046H | Recombinant Human NOG protein, Fc-tagged | +Inquiry |
NOG-29H | Active Recombinant Human NOG Protein, Pre-aliquoted | +Inquiry |
NOG-3367H | Recombinant Human NOG Protein (Gln28-Cys232), His tagged | +Inquiry |
NOG-293H | Recombinant Human NOG protein | +Inquiry |
Nog-324R | Recombinant Rat Nog Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nog Products
Required fields are marked with *
My Review for All Nog Products
Required fields are marked with *
0
Inquiry Basket