Active Recombinant Human PLA2G4A protein, FLAG/His-tagged
Cat.No. : | PLA2G4A-42H |
Product Overview : | Recombinant Human PLA2G4A(aa 1-749) fused with FLAG/His tag at C-terminal was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Flag&His |
Protein Length : | 1-749 a.a. |
Description : | This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandins and leukotrienes, are lipid-based cellular hormones that regulate hemodynamics, inflammatory responses, and other intracellular pathways. The hydrolysis reaction also produces lysophospholipids that are converted into platelet-activating factor. The enzyme is activated by increased intracellular Ca(2+) levels and phosphorylation, resulting in its translocation from the cytosol and nucleus to perinuclear membrane vesicles. Alternative splicing results in multiple transcript variants. |
Form : | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 80 µg/ml FLAG peptide, and 20% glycerol. |
Bio-activity : | >57 pmol/min/µg |
Molecular Mass : | 87 kDa |
AA Sequence : | MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETF EFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCSCPDLRFSMA LCDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYV AGLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGML IGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFGSKF FMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGT ENEDAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDEL DAAVADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEK WAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETEEEKEIADFDI FDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFL SKPKADYKDDDDKHHHHHH |
Purity : | > 87% |
Storage : | >6 months at –80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) [ Homo sapiens ] |
Official Symbol | PLA2G4A |
Synonyms | PLA2G4A; phospholipase A2, group IVA (cytosolic, calcium-dependent); PLA2G4; cytosolic phospholipase A2; cPLA2 alpha; cPLA2; lysophospholipase; phospholipase A2 group IVA; phosphatidylcholine 2-acylhydrolase; calcium-dependent phospholipid-binding protein; cPLA2-alpha; MGC126350; |
Gene ID | 5321 |
mRNA Refseq | NM_024420 |
Protein Refseq | NP_077734 |
MIM | 600522 |
UniProt ID | P47712 |
Chromosome Location | 1q25 |
Pathway | ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Ca-dependent events, organism-specific biosystem; Endothelins, organism-specific biosystem; Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; |
Function | calcium ion binding; calcium-dependent phospholipase A2 activity; calcium-dependent phospholipid binding; hydrolase activity; lysophospholipase activity; phospholipase A2 activity; phospholipase A2 activity; |
◆ Recombinant Proteins | ||
PLA2G4A-752H | Active Recombinant Human PLA2G4A Protein, His-tagged | +Inquiry |
PLA2G4A-12895M | Recombinant Mouse PLA2G4A Protein, His-tagged | +Inquiry |
PLA2G4A-42H | Active Recombinant Human PLA2G4A protein, FLAG/His-tagged | +Inquiry |
PLA2G4A-6799M | Recombinant Mouse PLA2G4A Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G4A-4321HFL | Recombinant Full Length Human PLA2G4A protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G4A-3141HCL | Recombinant Human PLA2G4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G4A Products
Required fields are marked with *
My Review for All PLA2G4A Products
Required fields are marked with *
0
Inquiry Basket