Active Recombinant Human SOX2 protein
Cat.No. : | SOX2-67H |
Product Overview : | Recombinant human Sox2 cDNA (317 aa) was constructed with with flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain at the C terminus was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 0.50 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol. |
Bio-activity : | Cellular Toxicity: This recombinant protein was tested on mouse embryonic stem cells up to 50 µg/ml in culture medium. Suggested reprogramming protein concentration is between 0.5 to 8 ug / ml for both human and mouse fibroblast cells applications.Biolog |
AA Sequence : | MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRL GAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSM SYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS GPVPGTAINGTLPLSHMESGGGGSPGRRRRRRRRRRR |
Purity : | >95% by SDS-PAGE |
Applications : | 1. May be used for in vitro human Sox2 mediated iPS generation mechanism, or its gene specific transcription regulation study with intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for Sox2 protein-protein interaction mapping.4. May be used for specific antibody production. |
Storage : | Recombinant Human Sox2-11R is stable for six months at -20centigrade to -80centigrade. Store thawed tube at 4centigrade for seven days. Multiple freeze/thaw cycles may result in significant loss of activity. |
Gene Name | SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ] |
Official Symbol | SOX2 |
Synonyms | SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413; |
Gene ID | 6657 |
mRNA Refseq | NM_003106 |
Protein Refseq | NP_003097 |
MIM | 184429 |
UniProt ID | P48431 |
Chromosome Location | 3q26.3-q27 |
Pathway | Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; |
Function | DNA binding; DNA binding; miRNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
SOX2-608H | Recombinant Human SOX2 Protein, His-tagged | +Inquiry |
SOX2-966H | Recombinant Human SOX2 | +Inquiry |
SOX2-3519H | Recombinant Human SOX2 protein, His-SUMO-tagged | +Inquiry |
SOX2-6323H | Recombinant Human SOX2 protein, His-tagged | +Inquiry |
SOX2-1379H | Recombinant Human SOX2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX2-1561HCL | Recombinant Human SOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX2 Products
Required fields are marked with *
My Review for All SOX2 Products
Required fields are marked with *
0
Inquiry Basket