Recombinant Human SOX2 protein(121-310 aa), N-MBP & C-His-tagged
Cat.No. : | SOX2-2772H |
Product Overview : | Recombinant Human SOX2 protein(P48431)(121-310 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 121-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAING |
Gene Name | SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ] |
Official Symbol | SOX2 |
Synonyms | SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413; |
Gene ID | 6657 |
mRNA Refseq | NM_003106 |
Protein Refseq | NP_003097 |
MIM | 184429 |
UniProt ID | P48431 |
◆ Recombinant Proteins | ||
SOX2-1379H | Recombinant Human SOX2 protein, His-tagged | +Inquiry |
SOX2-2772H | Recombinant Human SOX2 protein(121-310 aa), N-MBP & C-His-tagged | +Inquiry |
SOX2-2049H | Recombinant Human SRY (Sex Determining Region Y)-Box 2, His-tagged | +Inquiry |
SOX2-6323H | Recombinant Human SOX2 protein, His-tagged | +Inquiry |
SOX2-3629H | Recombinant Human SOX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX2-1561HCL | Recombinant Human SOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX2 Products
Required fields are marked with *
My Review for All SOX2 Products
Required fields are marked with *
0
Inquiry Basket