Recombinant Human SOX2 protein(121-310 aa), N-MBP & C-His-tagged

• Cat.No.: SOX2-2772H
• Product Overview: Recombinant Human SOX2 protein(P48431)(121-310 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: N-MBP & C-His
• ProteinLength: 121-310 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAING
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ]
• Official Symbol: SOX2
• Synonyms: SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413
• Gene ID: 6657
• mRNA Refseq: NM_003106
• Protein Refseq: NP_003097
• MIM: 184429
• UniProt ID: P48431