Active Recombinant Human TGFB1 Protein

• Cat.No.: TGFB1-014H
• Product Overview: Recombinant Human TGFB1 Protein without tag was expressed in CHO cell.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 279-390 a.a.
• Bio-activity: Determined by TGF-β1's ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The expected ED50 is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2×10^7 units/mg.
• AA Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLEIVYYVGRKPKVEQLSNMIVRSCKCS
• Endotoxin: <0.1 ng/μg of protein (0.1 EU/μg)
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.
• Storage: Lyophilized protein remains stable before December 2022 when stored at -20 to 80 centigrade. Lyophilized protein can be stored at 4 centigrade for 6 months and room temperature for 1 month. Reconstituted protein can be stored at 2 to 8 centigrade for a week.
• Storage Buffer: Sterile filtered through a 0.2 micron filter. Lyophilized with no additives.
• Reconstitution: Centrifuge ival prior to opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not Vortex. Store at 2 centigrade to 8 centigrade for 1 week, or prepare for extended storage.
  Follow reconstitution with further dilution in a buffer containing a carrier protein (example 0.1 % BSA). Store working aliquots at -20 centigrade to -80 centigrade. Avoid repeated freeze-thaw cycles.
  Extended storage: -20 centigrade to -80 centigrde for 12 months.

Gene Information

• Gene Name: TGFB1 transforming growth factor beta 1 [ Homo sapiens (human) ]
• Official Symbol: TGFB1
• Synonyms: TGFB1; transforming growth factor beta 1; CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1; transforming growth factor beta-1 proprotein; TGF-beta-1; latency-associated peptide; prepro-transforming growth factor beta-1; transforming growth factor beta1
• Gene ID: 7040
• mRNA Refseq: NM_000660
• Protein Refseq: NP_000651
• MIM: 190180
• UniProt ID: P01137