Active Recombinant Human TGFB1 Protein
| Cat.No. : | TGFB1-014H |
| Product Overview : | Recombinant Human TGFB1 Protein without tag was expressed in CHO cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Protein Length : | 279-390 a.a. |
| Bio-activity : | Determined by TGF-β1's ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The expected ED50 is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2×10^7 units/mg. |
| AA Sequence : | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLEIVYYVGRKPKVEQLSNMIVRSCKCS |
| Endotoxin : | <0.1 ng/μg of protein (0.1 EU/μg) |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Storage : | Lyophilized protein remains stable before December 2022 when stored at -20 to 80 centigrade. Lyophilized protein can be stored at 4 centigrade for 6 months and room temperature for 1 month. Reconstituted protein can be stored at 2 to 8 centigrade for a week. |
| Storage Buffer : | Sterile filtered through a 0.2 micron filter. Lyophilized with no additives. |
| Reconstitution : | Centrifuge ival prior to opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not Vortex. Store at 2 centigrade to 8 centigrade for 1 week, or prepare for extended storage. Follow reconstitution with further dilution in a buffer containing a carrier protein (example 0.1 % BSA). Store working aliquots at -20 centigrade to -80 centigrade. Avoid repeated freeze-thaw cycles. Extended storage: -20 centigrade to -80 centigrde for 12 months. |
| Gene Name | TGFB1 transforming growth factor beta 1 [ Homo sapiens (human) ] |
| Official Symbol | TGFB1 |
| Synonyms | TGFB1; transforming growth factor beta 1; CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1; transforming growth factor beta-1 proprotein; TGF-beta-1; latency-associated peptide; prepro-transforming growth factor beta-1; transforming growth factor beta1 |
| Gene ID | 7040 |
| mRNA Refseq | NM_000660 |
| Protein Refseq | NP_000651 |
| MIM | 190180 |
| UniProt ID | P01137 |
| ◆ Recombinant Proteins | ||
| TGFB1-3209H | Recombinant Human TGFB1, His-tagged | +Inquiry |
| TGFB1-706H | Active Recombinant Human TGFB1 Protein, Fc tagged | +Inquiry |
| TGFB1-6544R | Recombinant Rhesus macaque TGFB1 protein, His-tagged | +Inquiry |
| TGFB1-5693R | Recombinant Rat TGFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TGFB1-6430H | Recombinant Human TGFB1 Protein (Leu30-Ser390), N-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
| TGFB1-445HKCL | Human TGFB1 Knockdown Cell Lysate | +Inquiry |
| TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
