Active Recombinant Human TNFRSF10B Protein
| Cat.No. : | TNFRSF10B-15H |
| Product Overview : | Recombinant Human TNFRSF10B Protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 6 ng/mL, measured in a cell proliferation assay using RPMI-8226 cells in the presence of 25 ng/mL of human TRAIL. |
| Molecular Mass : | ~15 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analyses. |
| Storage : | Lyophilized recombinant Human TRAIL Receptor-2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TRAIL Receptor-2 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | TNFRSF10B TNF receptor superfamily member 10b [ Homo sapiens (human) ] |
| Official Symbol | TNFRSF10B |
| Synonyms | TNFRSF10B; TNF receptor superfamily member 10b; DR5; CD262; KILLER; TRICK2; TRICKB; ZTNFR9; TRAILR2; TRICK2A; TRICK2B; TRAIL-R2; KILLER/DR5; tumor necrosis factor receptor superfamily member 10B; Fas-like protein; TNF-related apoptosis-inducing ligand receptor 2; apoptosis inducing protein TRICK2A/2B; apoptosis inducing receptor TRAIL-R2; cytotoxic TRAIL receptor-2; death domain containing receptor for TRAIL/Apo-2L; death receptor 5; p53-regulated DNA damage-inducible cell death receptor(killer); tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor-like protein ZTNFR9 |
| Gene ID | 8795 |
| mRNA Refseq | NM_003842 |
| Protein Refseq | NP_003833 |
| MIM | 603612 |
| UniProt ID | Q7Z2I8 |
| ◆ Recombinant Proteins | ||
| TNFRSF10B-518H | Active Recombinant Human TNFRSF10B | +Inquiry |
| TNFRSF10B-27023TH | Recombinant Human TNFRSF10B, Fc-tagged | +Inquiry |
| Tnfrsf10b-3321MF | Recombinant Mouse Tnfrsf10b Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
| TNFRSF10B-460H | Active Recombinant Human TNFRSF10B, Fc Chimera | +Inquiry |
| Tnfrsf10b-3321M | Active Recombinant Mouse Tnfrsf10b protein, His&hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
| TNFRSF10B-2397MCL | Recombinant Mouse TNFRSF10B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF10B Products
Required fields are marked with *
My Review for All TNFRSF10B Products
Required fields are marked with *



