Active Recombinant Human TNFRSF10B Protein

Cat.No. : TNFRSF10B-15H
Product Overview : Recombinant Human TNFRSF10B Protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 6 ng/mL, measured in a cell proliferation assay using RPMI-8226 cells in the presence of 25 ng/mL of human TRAIL.
Molecular Mass : ~15 kDa, observed by reducing SDS-PAGE.
AA Sequence : ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant Human TRAIL Receptor-2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TRAIL Receptor-2 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name TNFRSF10B TNF receptor superfamily member 10b [ Homo sapiens (human) ]
Official Symbol TNFRSF10B
Synonyms TNFRSF10B; TNF receptor superfamily member 10b; DR5; CD262; KILLER; TRICK2; TRICKB; ZTNFR9; TRAILR2; TRICK2A; TRICK2B; TRAIL-R2; KILLER/DR5; tumor necrosis factor receptor superfamily member 10B; Fas-like protein; TNF-related apoptosis-inducing ligand receptor 2; apoptosis inducing protein TRICK2A/2B; apoptosis inducing receptor TRAIL-R2; cytotoxic TRAIL receptor-2; death domain containing receptor for TRAIL/Apo-2L; death receptor 5; p53-regulated DNA damage-inducible cell death receptor(killer); tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor-like protein ZTNFR9
Gene ID 8795
mRNA Refseq NM_003842
Protein Refseq NP_003833
MIM 603612
UniProt ID Q7Z2I8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF10B Products

Required fields are marked with *

My Review for All TNFRSF10B Products

Required fields are marked with *

0
cart-icon
0
compare icon