Active Recombinant Human TNFRSF10B Protein
Cat.No. : | TNFRSF10B-15H |
Product Overview : | Recombinant Human TNFRSF10B Protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 6 ng/mL, measured in a cell proliferation assay using RPMI-8226 cells in the presence of 25 ng/mL of human TRAIL. |
Molecular Mass : | ~15 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant Human TRAIL Receptor-2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TRAIL Receptor-2 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | TNFRSF10B TNF receptor superfamily member 10b [ Homo sapiens (human) ] |
Official Symbol | TNFRSF10B |
Synonyms | TNFRSF10B; TNF receptor superfamily member 10b; DR5; CD262; KILLER; TRICK2; TRICKB; ZTNFR9; TRAILR2; TRICK2A; TRICK2B; TRAIL-R2; KILLER/DR5; tumor necrosis factor receptor superfamily member 10B; Fas-like protein; TNF-related apoptosis-inducing ligand receptor 2; apoptosis inducing protein TRICK2A/2B; apoptosis inducing receptor TRAIL-R2; cytotoxic TRAIL receptor-2; death domain containing receptor for TRAIL/Apo-2L; death receptor 5; p53-regulated DNA damage-inducible cell death receptor(killer); tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor-like protein ZTNFR9 |
Gene ID | 8795 |
mRNA Refseq | NM_003842 |
Protein Refseq | NP_003833 |
MIM | 603612 |
UniProt ID | Q7Z2I8 |
◆ Recombinant Proteins | ||
RFL25566HF | Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 10B(Tnfrsf10B) Protein, His-Tagged | +Inquiry |
TNFRSF10B-1435H | Recombinant Human TNFRSF10B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFRSF10B-1639R | Recombinant Rhesus Monkey TNFRSF10B Protein, hIgG4-tagged | +Inquiry |
Tnfrsf10b-2745R | Recombinant Rat Tnfrsf10b Protein, His-tagged | +Inquiry |
Tnfrsf10b-3292M | Active Recombinant Mouse Tnfrsf10b protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
TNFRSF10B-2397MCL | Recombinant Mouse TNFRSF10B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF10B Products
Required fields are marked with *
My Review for All TNFRSF10B Products
Required fields are marked with *