Active Recombinant Human TNFRSF1A Protein

Cat.No. : TNFRSF1A-252H
Product Overview : Recombinant Human TNFRSF1A Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Tumor necrosis factor receptor type 1 (TNFR1) is expressed in most tissues and is activated by soluble and membrane-bound tumor necrosis factor alpha (TNFa). TNFR1 activates NF-κB and MAPK pathways to induce inflammation, promote apoptotic cell death, inhibit tumorigenesis, and inhibit viral replication.
Bio-activity : Neutralization of human TNF alpha induced L929 cell cytolysis, ≤100 ng/mL
Molecular Mass : Monomer, 18.3 kDa (162 aa)
AA Sequence : MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name TNFRSF1A tumor necrosis factor receptor superfamily, member 1A [ Homo sapiens (human) ]
Official Symbol TNFRSF1A
Synonyms TNFRSF1A; tumor necrosis factor receptor superfamily, member 1A; TNFR1; tumor necrosis factor receptor superfamily member 1A; CD120a; TNF R; TNF R I; TNF R55; TNFAR; TNFR60; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; FPF; p55; p60; TBP1; TNF-R; p55-R; TNFR55; TNF-R-I; TNF-R55; MGC19588;
Gene ID 7132
mRNA Refseq NM_001065
Protein Refseq NP_001056
MIM 191190
UniProt ID P19438

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF1A Products

Required fields are marked with *

My Review for All TNFRSF1A Products

Required fields are marked with *

0
cart-icon
0
compare icon