Active Recombinant Human TNFSF14 protein, hFc-Myc-tagged
| Cat.No. : | TNFSF14-4603H |
| Product Overview : | Recombinant Human TNFSF14 protein(O43557)(74-240aa), fused to N-terminal hFc tag and Myc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Fc&Myc |
| Protein Length : | 74-240aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml. |
| Molecular Mass : | 46.7 kDa |
| AA Sequence : | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 88% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | TNFSF14 tumor necrosis factor (ligand) superfamily, member 14 [ Homo sapiens ] |
| Official Symbol | TNFSF14 |
| Synonyms | TNFSF14; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; CD258; HVEM L; LIGHT; LTg; delta transmembrane LIGHT; herpesvirus entry mediator A; herpesvirus entry mediator ligand; herpesvirus entry mediator-ligand; herpes virus entry mediator ligand; ligand for herpesvirus entry mediator; tumor necrosis factor receptor-like 2; tumor necrosis factor superfamily member LIGHT; TR2; HVEML; |
| Gene ID | 8740 |
| mRNA Refseq | NM_003807 |
| Protein Refseq | NP_003798 |
| MIM | 604520 |
| UniProt ID | O43557 |
| ◆ Recombinant Proteins | ||
| TNFSF14-7782H | Recombinant Human TNFSF14 protein, His & S-tagged | +Inquiry |
| Tnfsf14-147M | Recombinant Mouse Tnfsf14 Protein | +Inquiry |
| TNFSF14-4603H | Active Recombinant Human TNFSF14 protein, hFc-Myc-tagged | +Inquiry |
| TNFSF14-552H | Recombinant Human TNFSF14 protein, Fc-tagged | +Inquiry |
| TNFSF14-970H | Active Recombinant Human TNFSF14 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF14-891HCL | Recombinant Human TNFSF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF14 Products
Required fields are marked with *
My Review for All TNFSF14 Products
Required fields are marked with *
