Active Recombinant Human TNFSF14 protein, hFc-Myc-tagged
Cat.No. : | TNFSF14-4603H |
Product Overview : | Recombinant Human TNFSF14 protein(O43557)(74-240aa), fused to N-terminal hFc tag and Myc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc&Myc |
Protein Length : | 74-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml. |
Molecular Mass : | 46.7 kDa |
AA Sequence : | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 88% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | TNFSF14 tumor necrosis factor (ligand) superfamily, member 14 [ Homo sapiens ] |
Official Symbol | TNFSF14 |
Synonyms | TNFSF14; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; CD258; HVEM L; LIGHT; LTg; delta transmembrane LIGHT; herpesvirus entry mediator A; herpesvirus entry mediator ligand; herpesvirus entry mediator-ligand; herpes virus entry mediator ligand; ligand for herpesvirus entry mediator; tumor necrosis factor receptor-like 2; tumor necrosis factor superfamily member LIGHT; TR2; HVEML; |
Gene ID | 8740 |
mRNA Refseq | NM_003807 |
Protein Refseq | NP_003798 |
MIM | 604520 |
UniProt ID | O43557 |
◆ Recombinant Proteins | ||
Tnfsf14-147M | Recombinant Mouse Tnfsf14 Protein | +Inquiry |
TNFSF14-217HF | Recombinant Human TNFSF14 Protein, His-tagged, FITC conjugated | +Inquiry |
TNFSF14-4603H | Active Recombinant Human TNFSF14 protein, hFc-Myc-tagged | +Inquiry |
TNFSF14-552HAF555 | Recombinant Human TNFSF14 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFSF14-217H | Recombinant Human TNFSF14 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF14-891HCL | Recombinant Human TNFSF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF14 Products
Required fields are marked with *
My Review for All TNFSF14 Products
Required fields are marked with *