Active Recombinant Human TNFSF14 protein, hFc-Myc-tagged

Cat.No. : TNFSF14-4603H
Product Overview : Recombinant Human TNFSF14 protein(O43557)(74-240aa), fused to N-terminal hFc tag and Myc tag, was expressed in Mammalian cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Fc&Myc
Protein Length : 74-240aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.
Molecular Mass : 46.7 kDa
AA Sequence : DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 88% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name TNFSF14 tumor necrosis factor (ligand) superfamily, member 14 [ Homo sapiens ]
Official Symbol TNFSF14
Synonyms TNFSF14; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; CD258; HVEM L; LIGHT; LTg; delta transmembrane LIGHT; herpesvirus entry mediator A; herpesvirus entry mediator ligand; herpesvirus entry mediator-ligand; herpes virus entry mediator ligand; ligand for herpesvirus entry mediator; tumor necrosis factor receptor-like 2; tumor necrosis factor superfamily member LIGHT; TR2; HVEML;
Gene ID 8740
mRNA Refseq NM_003807
Protein Refseq NP_003798
MIM 604520
UniProt ID O43557

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF14 Products

Required fields are marked with *

My Review for All TNFSF14 Products

Required fields are marked with *

0
cart-icon