Active Recombinant Human TSLP Protein (132 aa)
Cat.No. : | TSLP-052T |
Product Overview : | Recombinant Human TSLP Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 132 |
Description : | TSLP is a hemopoietic protein that is expressed in the heart, liver and prostate. TSLP overlaps biological activities with IL-7 and binds with the heterodimeric receptor complex consisting of the IL-7R alpha chain (IL-7Rα) and the TSLP-specific chain (TSLPR). Like IL-7, TSLP induces phosphorylation of STAT3 and STAT5, but uses kinases other than the JAKs for activation. TSLP prohibited apoptosis and stimulated growth of the human acute myeloid leukemia (AML)-derived cell line MUTZ3. It induces the release of T cell-attracting chemokines TARC and MDC from monocytes and activates CD11c(+) dendritic cells (DCs). TSLP activated DCs primed naive T cells to produce the proallergic cytokines (IL-4, IL-5, IL-13, TNFα) while down-regulating IL-10 and IFN-γ suggesting a role in initiating allergic inflammation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as measured by its ability to induce proliferation of human IL-7Rα and human TSLP R co-transfected mouse BaF3 cells is less than 0.3 ng/mL, corresponding to a Specific Activity of >3.3 × 10^6 IU/mg. |
Molecular Mass : | Approximately 15.0 KDa, a single non-glycosylated polypeptide chain containing 132 amino acids. |
AA Sequence : | MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Endotoxin : | Less than 1 EU/mg of rHuTSLP as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TSLP thymic stromal lymphopoietin [ Homo sapiens ] |
Official Symbol | TSLP |
Synonyms | TSLP; thymic stromal lymphopoietin; |
Gene ID | 85480 |
mRNA Refseq | NM_033035 |
Protein Refseq | NP_149024 |
MIM | 607003 |
UniProt ID | Q969D9 |
◆ Recombinant Proteins | ||
TSLP-3191H | Recombinant Human TSLP protein, His-Avi-tagged, Biotinylated | +Inquiry |
TSLP-258H | Recombinant Human TSLP Protein | +Inquiry |
TSLP-2147H | Recombinant Human Thymic Stromal Lymphopoietin, Fc Chimera | +Inquiry |
TSLP-6336R | Recombinant Rabbit TSLP protein, His-SUMO-tagged | +Inquiry |
TSLP-255C | Recombinant Cynomolgus TSLP protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *
0
Inquiry Basket