Active Recombinant Human VEGF165 Protein

Cat.No. : VEGF165-12H
Product Overview : Recombinant Human VEGF165 Protein without tag was expressed in E. coli. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
Bio-activity : Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/mL.
Molecular Mass : 38.2 kDa
AA Sequence : APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ]
Official Symbol VEGFA
Synonyms VEGFA; vascular endothelial growth factor A; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular permeability factor
Gene ID 7422
mRNA Refseq NM_003376
Protein Refseq NP_003367
MIM 192240
UniProt ID P15692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0
cart-icon
0
compare icon