Active Recombinant Human VEGF165 Protein
Cat.No. : | VEGF165-12H |
Product Overview : | Recombinant Human VEGF165 Protein without tag was expressed in E. coli. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/mL. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular permeability factor |
Gene ID | 7422 |
mRNA Refseq | NM_003376 |
Protein Refseq | NP_003367 |
MIM | 192240 |
UniProt ID | P15692 |
◆ Recombinant Proteins | ||
VEGFA-7854H | Recombinant Human VEGFA protein, His-tagged | +Inquiry |
VEGFA-326H | Recombinant Active Human VEGFA (VEGF121) Protein, His-tagged(C-ter) | +Inquiry |
VEGFA-4965R | Recombinant Rhesus Macaque VEGFA Protein, His (Fc)-Avi-tagged | +Inquiry |
Vegfa-475MAF555 | Recombinant Mouse Vegfa Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
VEGFA-382H | Recombinant Human VEGFA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
0
Inquiry Basket