Active Recombinant Human VEGF165 Protein

• Cat.No.: VEGF165-12H
• Product Overview: Recombinant Human VEGF165 Protein without tag was expressed in E. coli. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.

Specification

• Species: Human
• Source: E.coli
• Description: VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
• Bio-activity: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/mL.
• Molecular Mass: 38.2 kDa
• AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular permeability factor
• Gene ID: 7422
• mRNA Refseq: NM_003376
• Protein Refseq: NP_003367
• MIM: 192240
• UniProt ID: P15692