Active Recombinant Human VTN/TMSB4X protein
Cat.No. : | VTN-95H |
Product Overview : | Recombinant human vitronectin (62–398aa) domain and full-length human Thymosin-b4 fusion protein cDNA were expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Bio-activity : | When coated onto tissue culture plastic, VTB fusion protein promotes one half maximal attachment of human cardiomytes cells in serum-free medium at< 0.1 µg / cm2. Maximum attachment should occur at approximately 0.5 µg / cm2. |
AA Sequence : | MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFSDKPDMAEIEKFDKSKLKKTETQE KNPLPSKETIEQEKQAGES |
Endotoxin : | < 30 EU per 1 µg of the protein by the LAL method |
Purity : | >95% by SDS-PAGE |
Applications : | 1. When coated at 0.5-1 ug/ ml per cm2 and combined with cardiomyocytes culture medium, this recombinant protein can be used as matrix protein for benefiting cardiomyocytes differentiation in vitro. |
Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | VTN vitronectin [ Homo sapiens ] |
Official Symbol | VTN |
Synonyms | VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT; |
Gene ID | 7448 |
mRNA Refseq | NM_000638 |
Protein Refseq | NP_000629 |
MIM | 193190 |
UniProt ID | P04004 |
Chromosome Location | 17q11.2 |
Pathway | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem |
Function | extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity; |
◆ Recombinant Proteins | ||
VTN-4507H | Recombinant Human VTN Protein, His (Fc)-Avi-tagged | +Inquiry |
VTN-21H | Recombinant Human vitronectin Protein, His-tagged | +Inquiry |
Vtn-6957M | Recombinant Mouse Vtn Protein, Myc/DDK-tagged | +Inquiry |
VTN-6618C | Recombinant Chicken VTN | +Inquiry |
VTN-54H | Active Recombinant Human VTN Protein, Animal Free | +Inquiry |
◆ Native Proteins | ||
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
Vtn-683R | Native Rat Vitronectin | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
VTN -51P | Native Porcine multimeric vitronectin | +Inquiry |
VTN -61R | Native Rabbit multimeric vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTN-2062MCL | Recombinant Mouse VTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VTN Products
Required fields are marked with *
My Review for All VTN Products
Required fields are marked with *
0
Inquiry Basket