Active Recombinant Human VTN/TMSB4X protein
| Cat.No. : | VTN-95H |
| Product Overview : | Recombinant human vitronectin (62–398aa) domain and full-length human Thymosin-b4 fusion protein cDNA were expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Bio-activity : | When coated onto tissue culture plastic, VTB fusion protein promotes one half maximal attachment of human cardiomytes cells in serum-free medium at< 0.1 µg / cm2. Maximum attachment should occur at approximately 0.5 µg / cm2. |
| AA Sequence : | MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFSDKPDMAEIEKFDKSKLKKTETQE KNPLPSKETIEQEKQAGES |
| Endotoxin : | < 30 EU per 1 µg of the protein by the LAL method |
| Purity : | >95% by SDS-PAGE |
| Applications : | 1. When coated at 0.5-1 ug/ ml per cm2 and combined with cardiomyocytes culture medium, this recombinant protein can be used as matrix protein for benefiting cardiomyocytes differentiation in vitro. |
| Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | VTN vitronectin [ Homo sapiens ] |
| Official Symbol | VTN |
| Synonyms | VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT; |
| Gene ID | 7448 |
| mRNA Refseq | NM_000638 |
| Protein Refseq | NP_000629 |
| MIM | 193190 |
| UniProt ID | P04004 |
| Chromosome Location | 17q11.2 |
| Pathway | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem |
| Function | extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity; |
| ◆ Recombinant Proteins | ||
| VTN-062H | Recombinant Human VTN Protein, His-tagged | +Inquiry |
| VTN-53H | Recombinant Human VTN Protein, V62-R398, His tagged | +Inquiry |
| Vtn-1767M | Recombinant Mouse Vtn protein, His-tagged | +Inquiry |
| VTN-239H | Active Recombinant Human VTN protein | +Inquiry |
| VTN-221H | Recombinant Human VTN(Val62-Leu478) Protein, C-6*His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VTN -61R | Native Rabbit multimeric vitronectin | +Inquiry |
| Vtn-683R | Native Rat Vitronectin | +Inquiry |
| VTN-385P | Native Pig Vitronectin | +Inquiry |
| VTN -51P | Native Porcine multimeric vitronectin | +Inquiry |
| Vtn-694M | Native Mouse Vitronectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VTN-2062MCL | Recombinant Mouse VTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VTN Products
Required fields are marked with *
My Review for All VTN Products
Required fields are marked with *
