Active Recombinant Mouse Acvr2a Protein, mFc tagged

Cat.No. : Acvr2a-01M
Product Overview : Recombinant Mouse Acvr2a Protein with mFc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : mFc
Protein Length : 21-134aa
Description : Enables several functions, including BMP receptor activity; PDZ domain binding activity; and activin binding activity. Acts upstream of or within several processes, including Sertoli cell proliferation; copulation; and embryonic skeletal system development. Located in cell surface. Is expressed in several structures, including central nervous system; early conceptus; gonad; gut; and sensory organ. Used to study Weissenbacher-Zweymuller syndrome. Human ortholog(s) of this gene implicated in colon cancer. Orthologous to human ACVR2A (activin A receptor type 2A).
Bio-activity : The ED50 is 0.1689 ng/mL in the presence of 3 ng/mL recombinant Activin. The activity was measured by its ability to neutralize Activin-mediated inhibition on K562 cell proliferation.
Molecular Mass : The protein has a calculated MW of 40 kDa.
AA Sequence : ILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Endotoxin : < 0.1 EU/μg
Purity : < 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 6.92 mg/mL by BCA
Storage Buffer : Sterile PBS, pH 7.4
Gene Name Acvr2a activin receptor IIA [ Mus musculus (house mouse) ]
Official Symbol Acvr2a
Synonyms ACVR2A; activin receptor IIA; activin receptor type-2A; ACTR-IIA; activin receptor type IIA; Acvr2; ActrIIa; TactrII;
Gene ID 11480
mRNA Refseq NM_007396
Protein Refseq NP_031422
UniProt ID P27038

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Acvr2a Products

Required fields are marked with *

My Review for All Acvr2a Products

Required fields are marked with *

0
cart-icon