Species : |
Mouse |
Source : |
HEK293 |
Tag : |
mFc |
Protein Length : |
21-134aa |
Description : |
Enables several functions, including BMP receptor activity; PDZ domain binding activity; and activin binding activity. Acts upstream of or within several processes, including Sertoli cell proliferation; copulation; and embryonic skeletal system development. Located in cell surface. Is expressed in several structures, including central nervous system; early conceptus; gonad; gut; and sensory organ. Used to study Weissenbacher-Zweymuller syndrome. Human ortholog(s) of this gene implicated in colon cancer. Orthologous to human ACVR2A (activin A receptor type 2A). |
Bio-activity : |
The ED50 is 0.1689 ng/mL in the presence of 3 ng/mL recombinant Activin. The activity was measured by its ability to neutralize Activin-mediated inhibition on K562 cell proliferation. |
Molecular Mass : |
The protein has a calculated MW of 40 kDa. |
AA Sequence : |
ILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
Endotoxin : |
< 0.1 EU/μg |
Purity : |
< 95% by SDS-PAGE |
Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : |
6.92 mg/mL by BCA |
Storage Buffer : |
Sterile PBS, pH 7.4 |