Active Recombinant Mouse Acvr2a Protein, mFc tagged
Cat.No. : | Acvr2a-01M |
Product Overview : | Recombinant Mouse Acvr2a Protein with mFc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | mFc |
Protein Length : | 21-134aa |
Description : | Enables several functions, including BMP receptor activity; PDZ domain binding activity; and activin binding activity. Acts upstream of or within several processes, including Sertoli cell proliferation; copulation; and embryonic skeletal system development. Located in cell surface. Is expressed in several structures, including central nervous system; early conceptus; gonad; gut; and sensory organ. Used to study Weissenbacher-Zweymuller syndrome. Human ortholog(s) of this gene implicated in colon cancer. Orthologous to human ACVR2A (activin A receptor type 2A). |
Bio-activity : | The ED50 is 0.1689 ng/mL in the presence of 3 ng/mL recombinant Activin. The activity was measured by its ability to neutralize Activin-mediated inhibition on K562 cell proliferation. |
Molecular Mass : | The protein has a calculated MW of 40 kDa. |
AA Sequence : | ILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
Endotoxin : | < 0.1 EU/μg |
Purity : | < 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 6.92 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
Gene Name | Acvr2a activin receptor IIA [ Mus musculus (house mouse) ] |
Official Symbol | Acvr2a |
Synonyms | ACVR2A; activin receptor IIA; activin receptor type-2A; ACTR-IIA; activin receptor type IIA; Acvr2; ActrIIa; TactrII; |
Gene ID | 11480 |
mRNA Refseq | NM_007396 |
Protein Refseq | NP_031422 |
UniProt ID | P27038 |
◆ Recombinant Proteins | ||
ACVR2A-494R | Recombinant Rat ACVR2A Protein | +Inquiry |
ACVR2A-255H | Recombinant Human ACVR2A Protein, GST-tagged | +Inquiry |
ACVR2A-884H | Recombinant Human ACVR2A Protein, Fc/His-tagged | +Inquiry |
ACVR2A-0785H | Recombinant Human ACVR2A Protein (P191-N487), Tag Free | +Inquiry |
RFL-13669HF | Recombinant Full Length Human Activin Receptor Type-2A(Acvr2A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ACVR2A-16H | Active Recombinant Human ACVR2A Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2A-2280MCL | Recombinant Mouse ACVR2A cell lysate | +Inquiry |
ACVR2A-3096HCL | Recombinant Human ACVR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Acvr2a Products
Required fields are marked with *
My Review for All Acvr2a Products
Required fields are marked with *