Active Recombinant Mouse Adipoq Protein, His-tagged

• Cat.No.: Adipoq-501M
• Product Overview: Mouse Adipoq (Q60994, 21 a.a. - 247 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 21-247 a.a.
• Description: Adiponectin (also referred to as GBP-28, apM1, AdipoQ and Acrp30) is a protein which in humans is encoded by the ADIPOQ gene. It is involved in regulating glucose levels as well as fatty acid breakdown.
• Form: Lyophilized
• Bio-activity: Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0 ug/ml.
• Molecular Mass: 35.0 kDa
• AA Sequence: RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
• Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
• Purity: 95%
• Applications: Functional Study; SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus ]
• Official Symbol: Adipoq
• Synonyms: ADIPOQ; adiponectin, C1Q and collagen domain containing; adiponectin; adipocyte-specific protein AdipoQ; adipocyte complement related protein; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; APN; Acdc; apM1; 30kDa; GBP28; adipo; Acrp30
• Gene ID: 11450
• mRNA Refseq: NM_009605
• Protein Refseq: NP_033735