Active Recombinant Mouse Adipoq Protein, His-tagged
Cat.No. : | Adipoq-501M |
Product Overview : | Mouse Adipoq (Q60994, 21 a.a. - 247 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 21-247 a.a. |
Description : | Adiponectin (also referred to as GBP-28, apM1, AdipoQ and Acrp30) is a protein which in humans is encoded by the ADIPOQ gene. It is involved in regulating glucose levels as well as fatty acid breakdown. |
Form : | Lyophilized |
Bio-activity : | Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0 ug/ml. |
Molecular Mass : | 35.0 kDa |
AA Sequence : | RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
Purity : | 95% |
Applications : | Functional Study; SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus ] |
Official Symbol | Adipoq |
Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; adiponectin; adipocyte-specific protein AdipoQ; adipocyte complement related protein; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; APN; Acdc; apM1; 30kDa; GBP28; adipo; Acrp30; |
Gene ID | 11450 |
mRNA Refseq | NM_009605 |
Protein Refseq | NP_033735 |
◆ Recombinant Proteins | ||
Adipoq-117M | Recombinant Mouse Adipoq, Globular Domain, His-tagged | +Inquiry |
Adipoq-3986M | Recombinant Mouse Adipoq Protein (Met1-Asn247), C-His tagged | +Inquiry |
ADIPOQ-02H | Recombinant Human ADIPOQ Protein, His-tagged | +Inquiry |
ADIPOQ-19H | Recombinant Human ACRP30 headless, FLAG-tagged | +Inquiry |
ADIPOQ-196A | Active Recombinant Human ADIPOQ Protein | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
0
Inquiry Basket