Active Recombinant Mouse Ccl24 Protein
Cat.No. : | Ccl24-151M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 24 (Ccl24) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Binds to CCR3. |
Bio-activity : | Determined by its ability to chemoattract murine lymphocytes using a concentration range of 10-100 ng/ml. |
Molecular Mass : | 10.3 kDa |
AA Sequence : | VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl24 chemokine (C-C motif) ligand 24 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl24 |
Synonyms | Ccl24; chemokine (C-C motif) ligand 24; CKb-6; MPIF-2; Scya24; C-C motif chemokine 24; CC chemokine CCL24; eosinophil chemotactic protein 2; eotaxin-2; small-inducible cytokine A24 |
Gene ID | 56221 |
mRNA Refseq | NM_019577 |
Protein Refseq | NP_062523 |
UniProt ID | Q9JKC0 |
◆ Recombinant Proteins | ||
CCL24-1294H | Recombinant Human CCL24 Protein (Val27-Cys119), C-His tagged | +Inquiry |
Ccl24-475M | Recombinant Mouse Ccl24 protein | +Inquiry |
Ccl24-1348M | Active Recombinant Mouse Ccl24 Protein | +Inquiry |
Ccl24-7855M | Recombinant Mouse Ccl24 protein, His-tagged | +Inquiry |
CCL24-2932HF | Recombinant Full Length Human CCL24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL24-437HCL | Recombinant Human CCL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl24 Products
Required fields are marked with *
My Review for All Ccl24 Products
Required fields are marked with *