Active Recombinant Mouse Ccl6 Protein
Cat.No. : | Ccl6-134M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 6 (Ccl6) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | CCL6(22-95) and CCL6(23-95) are potent chemoattractants. |
Bio-activity : | Determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml. |
Molecular Mass : | 10.7 kDa |
AA Sequence : | GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl6 chemokine (C-C motif) ligand 6 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl6 |
Synonyms | Ccl6; chemokine (C-C motif) ligand 6; c10; MRP-1; Scya6; C-C motif chemokine 6; CC chemokine C10; small-inducible cytokine A6 |
Gene ID | 20305 |
mRNA Refseq | NM_009139 |
Protein Refseq | NP_033165 |
UniProt ID | P27784 |
◆ Recombinant Proteins | ||
CCL6-1215R | Recombinant Rat CCL6 Protein | +Inquiry |
Ccl6-3993M | Recombinant Mouse Ccl6 protein, His-tagged | +Inquiry |
CCL6-480M | Recombinant Mouse CCL6 Protein | +Inquiry |
Ccl6-617M | Recombinant Mouse Ccl6 protein | +Inquiry |
CCL6-873R | Recombinant Rat CCL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL6-1896MCL | Recombinant Mouse CCL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl6 Products
Required fields are marked with *
My Review for All Ccl6 Products
Required fields are marked with *
0
Inquiry Basket