Active Recombinant Mouse Ccl6 Protein

• Cat.No.: Ccl6-134M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 6 (Ccl6) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: CCL6(22-95) and CCL6(23-95) are potent chemoattractants.
• Bio-activity: Determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml.
• Molecular Mass: 10.7 kDa
• AA Sequence: GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl6 chemokine (C-C motif) ligand 6 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl6
• Synonyms: Ccl6; chemokine (C-C motif) ligand 6; c10; MRP-1; Scya6; C-C motif chemokine 6; CC chemokine C10; small-inducible cytokine A6
• Gene ID: 20305
• mRNA Refseq: NM_009139
• Protein Refseq: NP_033165
• UniProt ID: P27784