Active Recombinant Mouse Ccl6 Protein

Cat.No. : Ccl6-134M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 6 (Ccl6) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : CCL6(22-95) and CCL6(23-95) are potent chemoattractants.
Bio-activity : Determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml.
Molecular Mass : 10.7 kDa
AA Sequence : GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Ccl6 chemokine (C-C motif) ligand 6 [ Mus musculus (house mouse) ]
Official Symbol Ccl6
Synonyms Ccl6; chemokine (C-C motif) ligand 6; c10; MRP-1; Scya6; C-C motif chemokine 6; CC chemokine C10; small-inducible cytokine A6
Gene ID 20305
mRNA Refseq NM_009139
Protein Refseq NP_033165
UniProt ID P27784

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl6 Products

Required fields are marked with *

My Review for All Ccl6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon