Recombinant Mouse CCL6 Protein

Cat.No. : CCL6-480M
Product Overview : Recombinant Mouse CCL6 protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Protein Length : 116
Description : Predicted to enable CCR1 chemokine receptor binding activity; chemoattractant activity; and chemokine activity. Predicted to be involved in several processes, including cellular response to cytokine stimulus; leukocyte chemotaxis; and positive regulation of ERK1 and ERK2 cascade. Predicted to act upstream of or within chemotaxis. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Is expressed in several structures, including brain and retina nuclear layer. Orthologous to several human genes including CCL23 (C-C motif chemokine ligand 23).
Form : Lyophilized
AA Sequence : MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Ccl6 chemokine (C-C motif) ligand 6 [ Mus musculus (house mouse) ]
Official Symbol CCL6
Synonyms CCL6; chemokine (C-C motif) ligand 6; C-C motif chemokine 6; CC chemokine C10; small inducible cytokine A6; small-inducible cytokine A6; c10; MRP-1; Scya6;
Gene ID 20305
mRNA Refseq NM_009139
Protein Refseq NP_033165
UniProt ID P27784

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL6 Products

Required fields are marked with *

My Review for All CCL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon