| Species : | Mouse | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | Non | 
                                
                                    | Protein Length : | 95 | 
                                
                                    | Description : | Chemokine (C-C motif) ligand 6 (CCL6), encoded by the gene CCL6, is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. Murine CCL6 is expressed in myelopoietic bone marrow cultures when stimulated with GM-CSF, M-CSF, IL-3 or IL-4 and has also been detected in an IL-2-dependent T cell line, where the expression is inhibited following T cell stimulation. It signals primarily through the CCR1 receptor. CCL6 is chemotactic for B cells, CD4+ T cells, monocytes and NK cells and also exhibits powerful suppressive activity on colony formation by different lineages of hematopoietic progenitors. The C10 contains the four highly conserved cysteine residues present in CC chemokines. | 
                                
                                    | Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, pH 8.0, 500 mM NaCl. | 
                                
                                    | Bio-activity  : | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml. | 
                                
                                    | Molecular Mass : | Approximately 10.7 kDa, a single non-glycosylated polypeptide chain containing 95 amino acids. | 
                                
                                    | AA Sequence : | GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA | 
                                
                                    | Endotoxin : | Less than 1 EU/µg of rMuC10/CCL6 as determined by LAL method. | 
                                
                                    | Purity : | >97% by SDS-PAGE and HPLC analysis. | 
                                
                                    | Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. | 
                                
                                    | Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |