Active Recombinant Mouse Ccl7 Protein
| Cat.No. : | Ccl7-002M |
| Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. |
| Bio-activity : | Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml. |
| Molecular Mass : | 8.5 kDa |
| AA Sequence : | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus (house mouse) ] |
| Official Symbol | Ccl7 |
| Synonyms | Ccl7; chemokine (C-C motif) ligand 7; fic; marc; mcp3; MCP-3; Scya7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; monocyte chemoattractant protein 3; monocyte chemotactic protein 3; small-inducible cytokine A7 |
| Gene ID | 20306 |
| mRNA Refseq | NM_013654 |
| Protein Refseq | NP_038682 |
| UniProt ID | Q03366 |
| ◆ Recombinant Proteins | ||
| Ccl7-635R | Recombinant Rat Ccl7 protein | +Inquiry |
| CCL7-72H | Recombinant Human CCL7 Protein | +Inquiry |
| CCL7-32M | Recombinant Mouse CCL7 Protein | +Inquiry |
| CCL7-385H | Active Recombinant Human Chemokine (C-C Motif) Ligand 7, HIgG1 Fc-tagged | +Inquiry |
| CCL7-80H | Recombinant Human CCL7 Protein, Biotin-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL7-170HCL | Recombinant Human CCL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl7 Products
Required fields are marked with *
My Review for All Ccl7 Products
Required fields are marked with *
