Active Recombinant Mouse Ccl7 Protein

• Cat.No.: Ccl7-002M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity.
• Bio-activity: Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml.
• Molecular Mass: 8.5 kDa
• AA Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl7
• Synonyms: Ccl7; chemokine (C-C motif) ligand 7; fic; marc; mcp3; MCP-3; Scya7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; monocyte chemoattractant protein 3; monocyte chemotactic protein 3; small-inducible cytokine A7
• Gene ID: 20306
• mRNA Refseq: NM_013654
• Protein Refseq: NP_038682
• UniProt ID: Q03366