Active Recombinant Mouse Ccl7 Protein
Cat.No. : | Ccl7-002M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. |
Bio-activity : | Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml. |
Molecular Mass : | 8.5 kDa |
AA Sequence : | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl7 |
Synonyms | Ccl7; chemokine (C-C motif) ligand 7; fic; marc; mcp3; MCP-3; Scya7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; monocyte chemoattractant protein 3; monocyte chemotactic protein 3; small-inducible cytokine A7 |
Gene ID | 20306 |
mRNA Refseq | NM_013654 |
Protein Refseq | NP_038682 |
UniProt ID | Q03366 |
◆ Recombinant Proteins | ||
CCL7-874R | Recombinant Rat CCL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL7-0643H | Recombinant Human CCL7 Protein, GST-Tagged | +Inquiry |
CCL7-199H | Recombinant Human Chemokine (C-C Motif) Ligand 7, His-tagged | +Inquiry |
CCL7-31H | Recombinant Human CCL7 Protein | +Inquiry |
CCL7-384H | Active Recombinant Human Chemokine (C-C Motif) Ligand 7, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL7-170HCL | Recombinant Human CCL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl7 Products
Required fields are marked with *
My Review for All Ccl7 Products
Required fields are marked with *
0
Inquiry Basket