Active Recombinant Mouse Ccl7 Protein

Cat.No. : Ccl7-002M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity.
Bio-activity : Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml.
Molecular Mass : 8.5 kDa
AA Sequence : QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus (house mouse) ]
Official Symbol Ccl7
Synonyms Ccl7; chemokine (C-C motif) ligand 7; fic; marc; mcp3; MCP-3; Scya7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; monocyte chemoattractant protein 3; monocyte chemotactic protein 3; small-inducible cytokine A7
Gene ID 20306
mRNA Refseq NM_013654
Protein Refseq NP_038682
UniProt ID Q03366

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl7 Products

Required fields are marked with *

My Review for All Ccl7 Products

Required fields are marked with *

0
cart-icon