| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
74 |
| Description : |
Rat CCL7, belonging to the CC chemokine family, is also named as MCP-3, because the sequence comparison suggested that the rat CCL7 is a homologue of the human MCP-3 and is postulated the rat MCP-3. The MCP-3 protein family signals through CCR2 expect MCP-1 and possess cross-reacts across species. CCL7/MCP3 has chemotactic functions for monocytes and eosinophils, but not for neutrophils. Additionally, it can activated NK cells as well as CD4+ and CD8+ T lymphocytes. CCL7 was found to interact with MMP2. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml. |
| Molecular Mass : |
Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
| AA Sequence : |
QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP |
| Endotoxin : |
Less than 1 EU/µg of rRtMCP-3/CCL7 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |