Recombinant Mouse CCL7 Protein

Cat.No. : CCL7-32M
Product Overview : Recombinant Mouse CCL7 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Monocyte chemotactic protein 3 (MCP-3), also called CCL7, is produced by macrophages and tumor cell lines. MCP-3 signals through the G protein-coupled receptors CCR1, CCR2, and CCR3. MCP-3 chemoattracts monocytes and regulates macrophage function during inflammation and metastasis.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 8.5 kDa (74 aa)
AA Sequence : QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus (house mouse) ]
Official Symbol CCL7
Synonyms CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; small inducible cytokine A7; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3; fic; marc; mcp3; MCP-3; Scya7;
Gene ID 20306
mRNA Refseq NM_013654
Protein Refseq NP_038682
UniProt ID Q03366

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL7 Products

Required fields are marked with *

My Review for All CCL7 Products

Required fields are marked with *

0
cart-icon