Recombinant Mouse CCL7 Protein
| Cat.No. : | CCL7-32M |
| Product Overview : | Recombinant Mouse CCL7 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Monocyte chemotactic protein 3 (MCP-3), also called CCL7, is produced by macrophages and tumor cell lines. MCP-3 signals through the G protein-coupled receptors CCR1, CCR2, and CCR3. MCP-3 chemoattracts monocytes and regulates macrophage function during inflammation and metastasis. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 8.5 kDa (74 aa) |
| AA Sequence : | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus (house mouse) ] |
| Official Symbol | CCL7 |
| Synonyms | CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; small inducible cytokine A7; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3; fic; marc; mcp3; MCP-3; Scya7; |
| Gene ID | 20306 |
| mRNA Refseq | NM_013654 |
| Protein Refseq | NP_038682 |
| UniProt ID | Q03366 |
| ◆ Recombinant Proteins | ||
| Ccl7-287M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 7 | +Inquiry |
| CCL7-291H | Recombinant Human CCL7, StrepII-tagged | +Inquiry |
| CCL7-384H | Active Recombinant Human Chemokine (C-C Motif) Ligand 7, HIgG1 Fc-tagged, mutant | +Inquiry |
| Ccl7-5245M | Recombinant Mouse Ccl7 protein, His-tagged | +Inquiry |
| CCL7-29150TH | Recombinant Human CCL7 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL7-170HCL | Recombinant Human CCL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL7 Products
Required fields are marked with *
My Review for All CCL7 Products
Required fields are marked with *
