Active Recombinant Mouse Cd40lg Protein
| Cat.No. : | Cd40lg-2063M |
| Product Overview : | Purified recombinant protein of Mouse CD40 ligand (Cd40lg) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. |
| Bio-activity : | Determined by its ability to induce TNF-alpha; and MIP-1alpha; production by murine splenocytes. The expected ED50 for this effect is > 0.1 μg/mL. |
| Molecular Mass : | 16.4 kDa |
| AA Sequence : | MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL |
| Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
| Gene Name | Cd40lg CD40 ligand [ Mus musculus (house mouse) ] |
| Official Symbol | Cd40lg |
| Synonyms | Cd40lg; CD40 ligand; IGM; IMD; gp3; Cd40; HIGM; IMD3; Ly-6; Ly62; T-BA; TRAP; Tnfs; gp39; CD154; Cd40l; HIGM1; Ly-62; T-BAM; CD40-L; Tnfsf5; Tnlg8b; CD40 ligand; T-cell antigen Gp39; TNF-related activation protein; tumor necrosis factor ligand 8b; tumor necrosis factor ligand superfamily member 5 |
| Gene ID | 21947 |
| mRNA Refseq | NM_011616 |
| Protein Refseq | NP_035746 |
| UniProt ID | P27548 |
| ◆ Recombinant Proteins | ||
| CD40LG-791R | Recombinant Rhesus monkey CD40LG protein, His-tagged | +Inquiry |
| CD40LG-166C | Recombinant Canine CD40LG | +Inquiry |
| CD40LG-102HB | Recombinant Human CD40LG protein, His-Flag-tagged, Biotinylated | +Inquiry |
| CD40LG-782C | Recombinant Cattle CD40LG protein, His & GST-tagged | +Inquiry |
| CD40LG-911R | Recombinant Rat CD40LG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CD40LG-30M | Recombinant Monkey CD40LG Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD40LG-1965HCL | Recombinant Human CD40LG cell lysate | +Inquiry |
| CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
| CD40LG-1080CCL | Recombinant Cynomolgus CD40LG cell lysate | +Inquiry |
| CD40LG-001CCL | Recombinant Canine CD40LG cell lysate | +Inquiry |
| CD40LG-1548MCL | Recombinant Mouse CD40LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd40lg Products
Required fields are marked with *
My Review for All Cd40lg Products
Required fields are marked with *
