Active Recombinant Mouse Cd40lg Protein

Cat.No. : Cd40lg-2063M
Product Overview : Purified recombinant protein of Mouse CD40 ligand (Cd40lg) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching.
Bio-activity : Determined by its ability to induce TNF-alpha; and MIP-1alpha; production by murine splenocytes. The expected ED50 for this effect is > 0.1 μg/mL.
Molecular Mass : 16.4 kDa
AA Sequence : MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Cd40lg CD40 ligand [ Mus musculus (house mouse) ]
Official Symbol Cd40lg
Synonyms Cd40lg; CD40 ligand; IGM; IMD; gp3; Cd40; HIGM; IMD3; Ly-6; Ly62; T-BA; TRAP; Tnfs; gp39; CD154; Cd40l; HIGM1; Ly-62; T-BAM; CD40-L; Tnfsf5; Tnlg8b; CD40 ligand; T-cell antigen Gp39; TNF-related activation protein; tumor necrosis factor ligand 8b; tumor necrosis factor ligand superfamily member 5
Gene ID 21947
mRNA Refseq NM_011616
Protein Refseq NP_035746
UniProt ID P27548

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cd40lg Products

Required fields are marked with *

My Review for All Cd40lg Products

Required fields are marked with *

0
cart-icon
0
compare icon