"CD40LG" Related Products

Recombinant Rabbit CD40LG Protein (113-261 aa), His-tagged

Cat.No. : CD40LG-392R
Product Overview : Recombinant Rabbit CD40LG Protein (113-261 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
Description : Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
Source : E. coli
Species : Rabbit
Tag : His
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 20.2 kDa
Protein length : 113-261 aa
AA Sequence : MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : CD40LG CD40 ligand [ Oryctolagus cuniculus (rabbit) ]
Official Symbol : CD40LG
Synonyms : TNLG8B;
Gene ID : 100358388
mRNA Refseq : NM_001256781
Protein Refseq : NP_001243710.1
UniProt ID : G1SKP7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.