Recombinant Rabbit CD40LG Protein (113-261 aa), His-tagged
Cat.No. : | CD40LG-392R |
Product Overview : | Recombinant Rabbit CD40LG Protein (113-261 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His |
Protein Length : | 113-261 aa |
Description : | Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CD40LG CD40 ligand [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | CD40LG |
Synonyms | TNLG8B; |
Gene ID | 100358388 |
mRNA Refseq | NM_001256781 |
Protein Refseq | NP_001243710.1 |
UniProt ID | G1SKP7 |
◆ Recombinant Proteins | ||
CD40LG-166C | Recombinant Canine CD40LG | +Inquiry |
CD40LG-10H | Active Recombinant Human CD40LG Protein (116-261), N-FLAG tagged | +Inquiry |
CD40LG-117H | Recombinant Human CD40LG protein, His-tagged | +Inquiry |
CD40LG-787P | Recombinant Pig CD40LG protein, His & S-tagged | +Inquiry |
CD40LG-7294Z | Recombinant Zebrafish CD40LG | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40LG-1965HCL | Recombinant Human CD40LG cell lysate | +Inquiry |
CD40LG-001CCL | Recombinant Canine CD40LG cell lysate | +Inquiry |
CD40LG-1548MCL | Recombinant Mouse CD40LG cell lysate | +Inquiry |
CD40LG-1080CCL | Recombinant Cynomolgus CD40LG cell lysate | +Inquiry |
CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40LG Products
Required fields are marked with *
My Review for All CD40LG Products
Required fields are marked with *
0
Inquiry Basket