Recombinant Rabbit CD40LG Protein (113-261 aa), His-tagged

• Cat.No.: CD40LG-392R
• Product Overview: Recombinant Rabbit CD40LG Protein (113-261 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rabbit
• Source: E.coli
• Tag: His
• Protein Length: 113-261 aa
• Description: Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 20.2 kDa
• AA Sequence: MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: CD40LG CD40 ligand [ Oryctolagus cuniculus (rabbit) ]
• Official Symbol: CD40LG
• Synonyms: TNLG8B
• Gene ID: 100358388
• mRNA Refseq: NM_001256781
• Protein Refseq: NP_001243710.1
• UniProt ID: G1SKP7