Active Recombinant Mouse Ctf2 Protein

• Cat.No.: Ctf2-2357M
• Product Overview: Purified recombinant protein of Mouse cardiotrophin 2 (Ctf2) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Increases the platelet count associated with splenomegaly. May have an important role in neuronal precursor development and maturation.
• Bio-activity: ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.5-0.8 μg/mL.
• Molecular Mass: 19.8 kDa
• AA Sequence: MAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Ctf2 cardiotrophin 2 [ Mus musculus (house mouse) ]
• Official Symbol: Ctf2
• Synonyms: CTF2; cardiotrophin 2; cardiotrophin-2; CT-2; neuropoietin; NP; Gm494
• Gene ID: 244218
• mRNA Refseq: NM_198858
• Protein Refseq: NP_942155
• UniProt ID: P83714