Recombinant Mouse Ctf2 protein

Cat.No. : Ctf2-2068M
Product Overview : Recombinant Mouse Ctf2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 182
Description : Neuropoietin (NP; also known as cardiotrophin-2) is a 19.7 kDa member of the IL-6 family of cytokines. Considered to be the product of a gene duplication event involving cardiotrophin-1 (CT-1), it helps to define a subfamily within the IL-6 family that includes CT-1, CLC and CTNF. Mouse neuropoietin is synthesized as a 204 amino acid (aa) precursor that contains a 22 aa signal sequence and a 182 aa mature segment. The secreted molecule is characterized by the presence of four alpha-helices, typical of hematopoietic superfamily molecules. Mature murine neuropoietin shares 88%, 90% and 95% aa identity to chimpanzee, canine and rat neuropoietin, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH8.0, 500 mM NaCl, with 0.5 mM DTT.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 200 ng/ml, corresponding to a specific activity of > 5000 IU/mg.
Molecular Mass : Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids.
AA Sequence : APISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Endotoxin : Less than 1 EU/μg of rMuNeuropoietin as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ctf2
Official Symbol Ctf2
Synonyms CTF2; cardiotrophin 2; cardiotrophin-2; CT-2; neuropoietin; NP; Gm494;
Gene ID 244218
mRNA Refseq NM_198858
Protein Refseq NP_942155
UniProt ID P83714

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ctf2 Products

Required fields are marked with *

My Review for All Ctf2 Products

Required fields are marked with *

0
cart-icon
0
compare icon