Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
153 |
Description : |
Interleukin-19 (IL-19) is a cytokine belonging to the interleukin family. Structurally, IL-19 is grouped into the IL-10 sub-family, which also includes IL-20, IL-22, IL-24, and IL-26. In contrast to IL-10, which exists as a homodimer, IL-19 is stable and active as a monomer in vivo. IL-19 functions through the receptor complex composed of IL-20 Receptor α and IL-20 Receptor β, which is also utilized by IL-20 and IL-24. IL-19 is produced by active monocytes and stimulated synergistically by IL-17 and IL-13. The functions of IL-19 are to promote the development and function of Th2 cells and to enhance the production of Th2 cytokines. IL-19 is implicated in aging, vascular disease, Type I diabetes, and rheumatoid arthritis. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 50 ng/mL, measured by a cell proliferation assay using MCF-7 cells, corresponding to a specific activity of > 2 × 10^4 units/mg. |
Molecular Mass : |
17.7 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : |
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE analysis. |
Storage : |
Lyophilized recombinant mouse Interleukin-19 (rmIL-19) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-19 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against 50mM acetic acid. |
Reconstitution : |
Reconstituted in 50 mM acetic acid at 50 μg/mL. |