Active Recombinant Mouse Il19 Protein (153 aa)

Cat.No. : Il19-367I
Product Overview : Recombinant mouse Interleukin-19 (rmIL-19) produced in E. coli is a single non-glycosylated polypeptide chain containing of153 amino acids. A fully biologically active molecule, rmIL-19 has a molecular mass of 17.7 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 153
Description : Interleukin-19 (IL-19) is a cytokine belonging to the interleukin family. Structurally, IL-19 is grouped into the IL-10 sub-family, which also includes IL-20, IL-22, IL-24, and IL-26. In contrast to IL-10, which exists as a homodimer, IL-19 is stable and active as a monomer in vivo. IL-19 functions through the receptor complex composed of IL-20 Receptor α and IL-20 Receptor β, which is also utilized by IL-20 and IL-24. IL-19 is produced by active monocytes and stimulated synergistically by IL-17 and IL-13. The functions of IL-19 are to promote the development and function of Th2 cells and to enhance the production of Th2 cytokines. IL-19 is implicated in aging, vascular disease, Type I diabetes, and rheumatoid arthritis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 50 ng/mL, measured by a cell proliferation assay using MCF-7 cells, corresponding to a specific activity of > 2 × 10^4 units/mg.
Molecular Mass : 17.7 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant mouse Interleukin-19 (rmIL-19) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-19 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50mM acetic acid.
Reconstitution : Reconstituted in 50 mM acetic acid at 50 μg/mL.
Gene Name Il19 interleukin 19 [ Mus musculus ]
Official Symbol Il19
Synonyms IL19; interleukin 19; interleukin-19; IL-19;
Gene ID 329244
mRNA Refseq NM_001009940
Protein Refseq NP_001009940
UniProt ID Q8CJ70

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il19 Products

Required fields are marked with *

My Review for All Il19 Products

Required fields are marked with *

0
cart-icon
0
compare icon