| Species : |
Mouse |
| Source : |
Insect Cells |
| Tag : |
His |
| Protein Length : |
115-270 aa |
| Description : |
Enables cytokine activity. Involved in positive regulation of angiogenesis and positive regulation of vascular endothelial growth factor production. Acts upstream of or within several processes, including connective tissue replacement involved in inflammatory response wound healing; ectopic germ cell programmed cell death; and extrinsic apoptotic signaling pathway in absence of ligand. Located in extracellular space. Is expressed in several structures, including alimentary system; brain; early conceptus; genitourinary system; and hemolymphoid system. Human ortholog(s) of this gene implicated in several diseases, including Fabry disease; Schnitzler syndrome; autoimmune disease (multiple); hematologic cancer (multiple); and lung disease (multiple). Orthologous to human IL1A (interleukin 1 alpha). |
| Form : |
Liquid in Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Bio-activity : |
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 range ≤ 0.15 ng/mL. |
| Molecular Mass : |
19.0 kDa (165 aa) |
| AASequence : |
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
| Endotoxin : |
< 1 EU/μg by LAL |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Absorbance at 280nm) |
| Reference : |
1. Dinarello CA., et al. (1997) Semin Oncol. 24:S9-81-S9-93.
2. Bankers-Fulbright JL., et al. (1996) Life Sci. 59:61-83. |
