| Species : |
Mouse |
| Source : |
E.coli |
| Protein Length : |
153 |
| Description : |
Interleukin-1 Beta (IL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50< 2.0 pg/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of> 5.0 × 10^8units/mg. |
| Molecular Mass : |
17.5kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
| Storage : |
Lyophilized recombinant mouseInterleukin-1 Beta(rmIL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-1β should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |
