Active Recombinant Mouse Il1f5 Protein

Cat.No. : Il1f5-148M
Product Overview : Purified recombinant protein of Mouse interleukin 1 family, member 5 (delta) (Il1f5), transcript variant 2 without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2/IL-36R and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Bio-activity : Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
Molecular Mass : 17 kDa
AA Sequence : VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il1f5 interleukin 1 family, member 5 (delta) [ Mus musculus (house mouse) ]
Official Symbol Il1f5
Synonyms Il1f5; interleukin 1 family, member 5 (delta); IL36RN; Il-1h3; Il1hy1; IL-36Ra; AI413231; Fil1delta; interleukin-36 receptor antagonist protein; IL-1 delta; IL-1F5; IL-1HY1; IL-1L1; interleukin 1 receptor antagonist homolog 1; interleukin-1 HY1; interleukin-1 delta; interleukin-1 family member 5; interleukin-1 homolog 3; interleukin-1-like protein 1
Gene ID 54450
mRNA Refseq NM_019451
Protein Refseq NP_062324
UniProt ID Q9QYY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36RN Products

Required fields are marked with *

My Review for All IL36RN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon