Active Recombinant Mouse Il1f5 Protein
Cat.No. : | Il1f5-148M |
Product Overview : | Purified recombinant protein of Mouse interleukin 1 family, member 5 (delta) (Il1f5), transcript variant 2 without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2/IL-36R and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. |
Bio-activity : | Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs. |
Molecular Mass : | 17 kDa |
AA Sequence : | VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il1f5 interleukin 1 family, member 5 (delta) [ Mus musculus (house mouse) ] |
Official Symbol | Il1f5 |
Synonyms | Il1f5; interleukin 1 family, member 5 (delta); IL36RN; Il-1h3; Il1hy1; IL-36Ra; AI413231; Fil1delta; interleukin-36 receptor antagonist protein; IL-1 delta; IL-1F5; IL-1HY1; IL-1L1; interleukin 1 receptor antagonist homolog 1; interleukin-1 HY1; interleukin-1 delta; interleukin-1 family member 5; interleukin-1 homolog 3; interleukin-1-like protein 1 |
Gene ID | 54450 |
mRNA Refseq | NM_019451 |
Protein Refseq | NP_062324 |
UniProt ID | Q9QYY1 |
◆ Recombinant Proteins | ||
IL36RN-596H | Recombinant Human interleukin 36 receptor antagonist, His-tagged | +Inquiry |
IL36RN-2009H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
IL36RN-152H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
IL36RN-5788HF | Recombinant Full Length Human IL36RN Protein, GST-tagged | +Inquiry |
IL36RN-5185H | Recombinant Human IL36RN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *