Recombinant Mouse Il1f5 protein

Cat.No. : Il1f5-553M
Product Overview : Recombinant Mouse Il1f5 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 154
Description : Interleukin-36 receptor antagonist (IL-36RA) is a secreted protein which belongs to the interleukin 1 cytokine family (IL-1 family) and it is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RA has been reported to antagonize the biological activity of IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). Furthermore, it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). In addition, The receptor for IL-36RA has not been positively identified. Indirect evidence suggests it is IL-1Rrp2. Recombinant murine interleukin-36 RA contains 154 amino acid residues and it shares 91 % a.a. sequence identity with human IL-36RA.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
Molecular Mass : Approximately 16.9 kDa, a single non-glycosylated polypeptide chain containing 154 amino acids.
AA Sequence : VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
Endotoxin : Less than 1 EU/µg of rMuIL-36RA as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il1f5
Official Symbol Il1f5
Synonyms IL1F5; interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; IL-1F5; IL-1L1; IL-1HY1; IL-1 delta; interleukin-1 HY1; interleukin-1 delta; interleukin-1 homolog 3; interleukin-1-like protein 1; interleukin-1 family member 5; interleukin 1 receptor antagonist homolog 1; IL36RN; Il-1h3; Il1hy1; AI413231; Fil1delta;
Gene ID 54450
mRNA Refseq NM_001146087
Protein Refseq NP_001139559
UniProt ID Q9QYY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36RN Products

Required fields are marked with *

My Review for All IL36RN Products

Required fields are marked with *

0
cart-icon
0
compare icon