Active Recombinant Mouse Il20 Protein, His-Tagged
Cat.No. : | Il20-01M |
Product Overview : | Recombinant mouse Il20 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 20 (IL20) is a cytokine structurally related to interleukin 10 (IL-10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. |
Form : | Lyophilized powder |
AA Sequence : | MLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKK DLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <2 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il20 interleukin 20 [ Mus musculus (house mouse) ] |
Official Symbol | Il20 |
Synonyms | If2d; Zcyto10 |
Gene ID | 58181 |
mRNA Refseq | NM_001311091.1 |
Protein Refseq | NP_001298020.1 |
UniProt ID | Q9JKV9 |
◆ Recombinant Proteins | ||
IL20-1931H | Active Recombinant Human IL20 protein, His-tagged | +Inquiry |
IL20-172H | Recombinant Active Human IL20 Protein, His-tagged(C-ter) | +Inquiry |
Il20-262M | Active Recombinant Mouse Il20 Protein (Leu25-Leu176), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il20-173M | Recombinant Active Mouse IL20 Protein, His-tagged(C-ter) | +Inquiry |
IL20-3655H | Recombinant Human IL20 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL20-5233HCL | Recombinant Human IL20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il20 Products
Required fields are marked with *
My Review for All Il20 Products
Required fields are marked with *
0
Inquiry Basket