Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
21-140 a.a. |
Description : |
The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
Form : |
Lyophilized |
Bio-activity : |
The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 2 x 106 units/mg. |
Molecular Mass : |
14 kDa |
AA Sequence : |
HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Endotoxin : |
Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg). |
Purity : |
> 90% by SDS-PAGE and HPLC |
Applications : |
Functional Study SDS-PAGE |
Storage : |
Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : |
Lyophilized from PBS, pH 7.0 |