Active Recombinant Mouse Il4 Protein

• Cat.No.: Il4-5181M
• Product Overview: Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 21-140 a.a.
• Description: The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13.
• Form: Lyophilized
• Bio-activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 2 x 106 units/mg.
• Molecular Mass: 14 kDa
• AA Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
• Endotoxin: Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg).
• Purity: > 90% by SDS-PAGE and HPLC
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from PBS, pH 7.0

Gene Information

• Gene Name: Il4 interleukin 4 [ Mus musculus ]
• Official Symbol: Il4
• Synonyms: IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1
• Gene ID: 16189
• mRNA Refseq: NM_021283
• Protein Refseq: NP_067258