Active Recombinant Mouse Il4 Protein

Cat.No. : Il4-5181M
Product Overview : Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 21-140 a.a.
Description : The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13.
Form : Lyophilized
Bio-activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 2 x 106 units/mg.
Molecular Mass : 14 kDa
AA Sequence : HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Endotoxin : Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg).
Purity : > 90% by SDS-PAGE and HPLC
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from PBS, pH 7.0
Gene Name Il4 interleukin 4 [ Mus musculus ]
Official Symbol Il4
Synonyms IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1;
Gene ID 16189
mRNA Refseq NM_021283
Protein Refseq NP_067258

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il4 Products

Required fields are marked with *

My Review for All Il4 Products

Required fields are marked with *

0
cart-icon
0
compare icon