Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
26-189 |
Description : |
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
Form : |
Liquid |
Bio-activity : |
Murine LIF is fully biologically active when compared to standards. The ED50 as determined by the M1 cell differentiation assay is = 0.05 ng/mL, corresponding to a specific activity of = 2 × 10^7 units/mg. |
Molecular Mass : |
18 kDa |
AA Sequence : |
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : |
< 1.0 EU/μg of protein (determined by LAL method) |
Purity : |
> 95 % by SDS-PAGE |
Stability : |
Shelf life: one year from despatch. |
Storage : |
Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : |
1.0 mg/mL (determined by bradford assay) |
Storage Buffer : |
Phosphate buffer saline (pH 7.4) containing 10 % glycerol. |