| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
165 |
| Description : |
Stem Cell Factor (SCF) which binds to the c-Kit receptor is produced by fibroblasts and endothelial cells. The soluble and transmembrane forms of the protein are formed by alternative splicing of the same RNA transcript and the presence of both soluble and transmembrane SCF is required for normal hematopoietic function. SCF plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. In addition, it also promotes mast cell adhesion, migration, proliferation, and survival 3. Rat SCF shares 75 % 90 % a.a. sequence identity with canine, feline, mouse, and human SCF. Furthermore, rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 mast cells is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
| Molecular Mass : |
Approximately 18.5 kDa, a single non-glycosylated polypeptide chain containing 165 amino acids. |
| AA Sequence : |
MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Endotoxin : |
Less than 1 EU/µg of rRtSCF as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |