Active Recombinant Mouse LIF Protein, His-Tagged
Cat.No. : | LIF-01M |
Product Overview : | Recombinant mouse LIF Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | LIF, a pleiotrophic factor, is identified in multiple cell types, including T cells, myelomonocytic lineages, fibroblasts, liver, heart and melanoma. LIF is capable of promoting long-term maintenance of embryonic stem cells by inhibiting spontaneous differentiation. In addition, LIF also have abilities including stimulation of differentiation of cholinergic nerves, the stimulation of acute phase protein synthesis by hepatocytes, and suppression of adipogenesis by supressing the lipoprotein lipase in adipocytes. |
Form : | Lyophilized powder |
AA Sequence : | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSA SLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce IL-6 secretion in M1 cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse LIF is > 2 x 10^6 IU/mg. |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
◆ Recombinant Proteins | ||
LIF-301508H | Recombinant Human LIF protein, GST-tagged | +Inquiry |
LIF-2623H | Active Recombinant Human LIF protein, His-tagged | +Inquiry |
LIF-101H | Active Recombinant Human LIF Protein | +Inquiry |
Lif-043L | Active Recombinant Mouse Lif Protein (181 aa) | +Inquiry |
LIF-207M | Active Recombinant Mouse LIF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *
0
Inquiry Basket