Active Recombinant Mouse Pdgfa Protein
Cat.No. : | Pdgfa-4754M |
Product Overview : | Purified recombinant protein of Mouse platelet derived growth factor, PDGFAB, a disulfide-linked dimer, consisting of one A chain and one B chain without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB. |
Bio-activity : | ED50 as determined by the dose-dependent stimulation of thymidine uptake by BALB/c 3T3 cells is less than or equal to 1 ng/mL, corresponding to a specific activity of > 1 x 10^6 units/mg. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT beta chain: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Pdgfa platelet derived growth factor, alpha [ Mus musculus (house mouse) ] |
Official Symbol | Pdgfa |
Synonyms | PDGFA; platelet derived growth factor, alpha; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha polypeptide |
Gene ID | 18590 |
mRNA Refseq | NM_008808 |
Protein Refseq | NP_032834 |
UniProt ID | P20033 |
◆ Recombinant Proteins | ||
PDGFA-44H | Active Recombinant Human PDGFA Protein, Animal Free | +Inquiry |
PDGFA-3997R | Recombinant Rat PDGFA Protein, His (Fc)-Avi-tagged | +Inquiry |
PDGFA-375H | Active Recombinant Human Platelet-derived Growth Factor AA | +Inquiry |
Pdgfa-375R | Recombinant Rat Pdgfa protein | +Inquiry |
PDGFA-923C | Recombinant Canine PDGFA Protein (Ser87-Arg196), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pdgfa Products
Required fields are marked with *
My Review for All Pdgfa Products
Required fields are marked with *
0
Inquiry Basket