Active Recombinant Mouse Pdgfa Protein
Cat.No. : | Pdgfa-4755M |
Product Overview : | Purified recombinant protein of Mouse platelet derived growth factor, alpha (Pdgfa) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB. |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The expected ED50 for this effect is 8-10 ng/mL. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Unopened vial can be stored between 2 and 8 centigrade for up to 2 weeks, at -20 centigrade for up to 6 months, or at -70 centigrade or below until the expiration date. Aliquots can be stored between 2 and 8 centigrade for up to one week and stored at -20 centigrade or colder for up to 3 months. Avoid repeated freeze/thaw cycles. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Pdgfa platelet derived growth factor, alpha [ Mus musculus (house mouse) ] |
Official Symbol | Pdgfa |
Synonyms | PDGFA; platelet derived growth factor, alpha; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha polypeptide |
Gene ID | 18590 |
mRNA Refseq | NM_008808 |
Protein Refseq | NP_032834 |
UniProt ID | P20033 |
◆ Recombinant Proteins | ||
Pdgfa-215R | Active Recombinant Rat Pdgfa | +Inquiry |
Pdgfa-175M | Recombinant Mouse Pdgfa protein, His/S-tagged | +Inquiry |
PDGFA-56H | Recombinant Human PDGFAA | +Inquiry |
PDGFA-12567M | Recombinant Mouse PDGFA Protein | +Inquiry |
Pdgfa-048M | Recombinant Mouse Pdgfa Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pdgfa Products
Required fields are marked with *
My Review for All Pdgfa Products
Required fields are marked with *
0
Inquiry Basket