Active Recombinant Mouse Rspo1, Fc-tagged, Biotinylated
Cat.No. : | Rspo1-723M |
Product Overview : | The recombinant mouse RPSO1-Fc fusion is expressed as a 483 amino acid protein consisting of Ser21 - Gln265 region of (UniProt accession #Q9Z132) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-265 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 60 - 300 ng/ml. |
Molecular Mass : | Calculated molecular mass (kDa): 53.8; Estimated by SDS-PAGE under reducing condition (kDa): 55-60. |
AA Sequence : | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KCKIEHCEACFSHNFCTKCQEGLYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFR KGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQGRRENANRHPARKNSKEPGSNSRRHK GQQQPQPGTTGPLTSVGPTWAQSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | Rspo1 R-spondin homolog (Xenopus laevis) [ Mus musculus ] |
Official Symbol | Rspo1 |
Synonyms | RSPO1; R-spondin homolog (Xenopus laevis); R-spondin-1; cristin-3; mCristin-3; roof plate-specific spondin-1; thrombospondin type 1 domain containing gene Rspondin; cysteine-rich and single thrombospondin domain-containing protein 3; Rspondin; R-spondin; |
Gene ID | 192199 |
mRNA Refseq | NM_138683 |
Protein Refseq | NP_619624 |
MIM | |
UniProt ID | |
Function | heparin binding; receptor binding; |
◆ Recombinant Proteins | ||
RSPO1-0660H | Active Recombinant Human RSPO1 protein, Fc-tagged | +Inquiry |
Rspo1-1944R | Recombinant Rat Rspo1 protein, His-tagged | +Inquiry |
RSPO1-5825H | Recombinant Human RSPO1 Protein (Arg31-Ala263), C-His tagged | +Inquiry |
RSPO1-053H | Active Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
RSPO1-421H | Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO1-1918HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
RSPO1-001HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rspo1 Products
Required fields are marked with *
My Review for All Rspo1 Products
Required fields are marked with *