Species : |
Mouse |
Source : |
P.pastoris |
Protein Length : |
152 |
Description : |
Sharing 79% sequence identity with human Tumor Necrosis Factor-alpha (hTNF-α), mouse Tumor Necrosis Factor-alpha (mTNF-α) is a cytokine mainly expressed by immune cells. A type II transmembrane protein, TNF-α is further proteolytically processed to a soluble form. The trimeric active TNF-α then exerts its diverse biological properties including gapoptosis, inflammation, autoimmunity and cell proliferation by binding to TNF Receptor 1 and 2. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50< 0.01 ng/mL, measured by cytotoxicity assay using L929 cells, corresponding to a specific activity of >1 × 10^8units/mg. |
Molecular Mass : |
17kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
SQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Endotoxin : |
< 1 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by reducing SDS-PAGE. |
Storage : |
Lyophilized recombinant mouse Tumor Necrosis Factor-alpha (rmTNF-α) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmTNF-αshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |