Active Recombinant Mouse Tnf Protein (152 aa)

Cat.No. : Tnf-148T
Product Overview : Recombinant Mouse Tnf Protein (152 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : P.pastoris
Protein Length : 152
Description : Sharing 79% sequence identity with human Tumor Necrosis Factor-alpha (hTNF-α), mouse Tumor Necrosis Factor-alpha (mTNF-α) is a cytokine mainly expressed by immune cells. A type II transmembrane protein, TNF-α is further proteolytically processed to a soluble form. The trimeric active TNF-α then exerts its diverse biological properties including gapoptosis, inflammation, autoimmunity and cell proliferation by binding to TNF Receptor 1 and 2.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.01 ng/mL, measured by cytotoxicity assay using L929 cells, corresponding to a specific activity of >1 × 10^8units/mg.
Molecular Mass : 17kDa, observed by reducing SDS-PAGE.
AA Sequence : SQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by reducing SDS-PAGE.
Storage : Lyophilized recombinant mouse Tumor Necrosis Factor-alpha (rmTNF-α) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmTNF-αshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Tnf tumor necrosis factor [ Mus musculus ]
Official Symbol Tnf
Synonyms TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434;
Gene ID 21926
mRNA Refseq NM_013693
Protein Refseq NP_038721
UniProt ID P06804

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnf Products

Required fields are marked with *

My Review for All Tnf Products

Required fields are marked with *

0
cart-icon
0
compare icon