Active Recombinant Mouse Tnf Protein (163 aa), His-tagged

Cat.No. : Tnf-305T
Product Overview : Recombinant mouse Tumor Necrosis Factor-alpha (rmTNF-alpha) produced in E. coli is a non-glycosylated polypeptide chain of 163 amino acids. A fully biologically active molecule, rhTNF-alpha has a molecular mass of 18.3kDa analyzed by reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 163
Description : Tumor Necrosis Factor-Alpha (TNF-alpha) plays a major role in growth regulation, differentiation, inflammation, viral replication, tumorigenesis, and autoimmune diseases. Besides inducing hemorrhagic necrosis of tumors, TNF has been found to be involved in tumorigenesis, tumor metastasis, viral replication, septic shock, fever, inflammation, and autoimmune diseases including Crohn's disease, and rheumatoid arthritis as well as graft-versus-host disease. TNF alpha-1a is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.05 ng/mL, measured in a cytotoxicity assay using L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D, corresponding to a specific activity of > 27units/mg.
Molecular Mass : 18.3kDa, observed by reducing SDS-PAGE.
AA Sequence : MHHHHHHMLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by reducing SDS-PAGE.
Storage : Lyophilized recombinant mouse Tumor Necrosis Factor-alpha (rmTNF-slpha) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rmTNF-alpha should be stable up to 4 week at 4 centigrade or up to 6 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Tnf tumor necrosis factor [ Mus musculus ]
Official Symbol Tnf
Synonyms TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434;
Gene ID 21926
mRNA Refseq NM_013693
Protein Refseq NP_038721
UniProt ID P06804

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnf Products

Required fields are marked with *

My Review for All Tnf Products

Required fields are marked with *

0
cart-icon