Active Recombinant Rat Ccl20 Protein (71 aa)
Cat.No. : | Ccl20-170C |
Product Overview : | Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Protein Length : | 71 |
Description : | Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of rat MIP-3 α/CCL20 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCCR6 cells (human Gα15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/mL. |
Molecular Mass : | 8.2 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ccl20 chemokine (C-C motif) ligand 20 [ Rattus norvegicus ] |
Official Symbol | Ccl20 |
Synonyms | CCL20; chemokine (C-C motif) ligand 20; C-C motif chemokine 20; MIP-3-alpha; CC chemokine LARC; CC chemokine ST38; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; small inducible cytokine subfamily A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; ST38; Scya20; |
Gene ID | 29538 |
mRNA Refseq | NM_019233 |
Protein Refseq | NP_062106 |
UniProt ID | P97884 |
◆ Recombinant Proteins | ||
CCL20-161H | Recombinant Human CCL20 protein, His-tagged | +Inquiry |
CCL20-22H | Active Recombinant Human CCL20 Protein | +Inquiry |
CCL20-516H | Active Recombinant Human CCL20 Protein, MIgG2a Fc-tagged | +Inquiry |
CCL20-3403M | Recombinant Mouse CCL20 protein(Ala28-Met97) | +Inquiry |
CCL20-61H | Recombinant Human CCL20 Protein, Biotin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl20 Products
Required fields are marked with *
My Review for All Ccl20 Products
Required fields are marked with *
0
Inquiry Basket