| Species : |
Rat |
| Source : |
E.coli |
| Protein Length : |
155 |
| Description : |
Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. Interaction of M-CSF with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of several types of cancer, including breast and endometrial cancer. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 5 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg. |
| Molecular Mass : |
28 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE. |
| Storage : |
Lyophilized recombinant Rat Macrophage Colony Stimulating Factor(M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat M-CSF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against 50mM Tris, 150mM NaCl, pH 8.0. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |