Active Recombinant Rat Csf1 Protein (155 aa)

Cat.No. : Csf1-333C
Product Overview : Recombinant Rat Macrophage Colony Stimulating Factor (M-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 155 amino acids each. A fully biologically active molecule, rrM-CSF has a molecular mass of 28 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 155
Description : Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. Interaction of M-CSF with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of several types of cancer, including breast and endometrial cancer.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
Molecular Mass : 28 kDa, observed by reducing SDS-PAGE.
AA Sequence : MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Rat Macrophage Colony Stimulating Factor(M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat M-CSF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50mM Tris, 150mM NaCl, pH 8.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus ]
Official Symbol Csf1
Synonyms CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; MCSF; CSF-1;
Gene ID 78965
mRNA Refseq NM_023981
Protein Refseq NP_076471
UniProt ID Q8JZQ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf1 Products

Required fields are marked with *

My Review for All Csf1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon