Active Recombinant Rat Egf Protein
Cat.No. : | Egf-291E |
Product Overview : | Recombinant Rat Egf Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Description : | Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.1 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | ~6 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Egf epidermal growth factor [ Rattus norvegicus ] |
Official Symbol | Egf |
Synonyms | EGF; epidermal growth factor; pro-epidermal growth factor; |
Gene ID | 25313 |
mRNA Refseq | NM_012842 |
Protein Refseq | NP_036974 |
UniProt ID | P07522 |
◆ Recombinant Proteins | ||
EGF-316M | Active Recombinant Mouse EGF, MIgG2a Fc-tagged | +Inquiry |
EGF-12320H | Recombinant Human EGF protein, GST-tagged | +Inquiry |
EGF-76R | Active Recombinant Rat EGF Protein | +Inquiry |
EGF-09H | Active Recombinant Human EGF Protein | +Inquiry |
Egf-2814M | Recombinant Mouse Egf protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Egf Products
Required fields are marked with *
My Review for All Egf Products
Required fields are marked with *
0
Inquiry Basket