Active Recombinant Rat Egf Protein

Cat.No. : Egf-291E
Product Overview : Recombinant Rat Egf Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Description : Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.1 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : ~6 kDa, observed by reducing SDS-PAGE.
AA Sequence : MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Egf epidermal growth factor [ Rattus norvegicus ]
Official Symbol Egf
Synonyms EGF; epidermal growth factor; pro-epidermal growth factor;
Gene ID 25313
mRNA Refseq NM_012842
Protein Refseq NP_036974
UniProt ID P07522

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Egf Products

Required fields are marked with *

My Review for All Egf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon