Active Recombinant Rat Il1b Protein
Cat.No. : | Il1b-180I |
Product Overview : | Recombinant Rat Il1b Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Description : | Interleukin-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 pg/mL, measured in a cell proliferation assay using D10S cells, corresponding to a specific activity of >1 × 10^8 units/mg |
Molecular Mass : | 17~22 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat Interleukin 1β(IL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat IL-1β should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il1b interleukin 1 beta [ Rattus norvegicus ] |
Official Symbol | Il1b |
Synonyms | IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; |
Gene ID | 24494 |
mRNA Refseq | NM_031512 |
Protein Refseq | NP_113700 |
UniProt ID | Q63264 |
◆ Recombinant Proteins | ||
Il1B-39H | Recombinant Human Il1B protein, low endotoxin | +Inquiry |
Il1b-161M | Recombinant Active Mouse IL1B Protein, His-tagged(C-ter) | +Inquiry |
Il1b-2829G | Recombinant Guinea pig Il1b protein, His & S-tagged | +Inquiry |
IL1B-364I | Active Recombinant Pig IL1B Protein (154 aa) | +Inquiry |
IL1β-82P | Recombinant Porcine Interleukin-1 beta | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *
0
Inquiry Basket