Species : |
Rat |
Source : |
HEK293 |
Description : |
Interleukin-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 10 pg/mL, measured in a cell proliferation assay using D10S cells, corresponding to a specific activity of >1 × 10^8 units/mg |
Molecular Mass : |
17~22 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant Rat Interleukin 1β(IL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat IL-1β should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |